Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PRNP Polyclonal Antibody – Cat# AAA201165 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PrnpSample Type: Mouse Kidney lysatesAntibody Dilution: 1.0ug/ml)

Major Prion Protein (PRNP) Antibody – Rabbit Polyclonal

Prnp Antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Human, Rat, Cow, Dog, Goat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Prnp, Antibody; Prnp Antibody - middle region; anti-PRNP antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Human, Rat, Cow, Dog, Goat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF
Sequence Length
254
Applicable Applications for anti-PRNP antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Human: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Prnp
Protein Size (# AA)
254 amino acids
Protein Interactions
Dpp6; Eri3; Syn1; Grb2; Opcml; Lsamp; Ntm; Atp1a3; Igsf8; Cadm3; Clstn1; Pde10a; Adam23; Ywhaz; Ywhae; Stxbp1; Plp1; P4hb; Ncam2; Ncam1; Mog; Mbp; Mag; L1cam; Hspa5; Gnb1; Sparcl1; Dnm1; Dpysl2; Cntn1; Clu; Atp2b2; Atp1b1; Atp1a1; App; Apoe; Aplp2; Apbb1;
Blocking Peptide
For anti-Prnp (MBS3215911) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: PrnpSample Type: Mouse Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-PRNP Polyclonal Antibody – Cat# AAA201165 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PrnpSample Type: Mouse Kidney lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-PRNP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Plasma membrane and cytoplasm in Leydig cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-PRNP Polyclonal Antibody – Cat# AAA201165 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-PRNP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Plasma membrane and cytoplasm in Leydig cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PRNP antibody
Target Description: Prnp may play a role in neuronal development and synaptic plasticity, may be required for neuronal myelin sheath maintenance and may play a role in iron uptake and iron homeostasis. Prnp is a soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. It also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains.
Product Categories/Family for anti-PRNP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
major prion protein
UniProt Protein Name
Major prion protein
UniProt Gene Name
Prnp
UniProt Synonym Gene Names
Prn-p; Prp; PrP
UniProt Entry Name
PRIO_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PRNP prnp (Catalog #AAA201165) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Prnp Antibody - middle region reacts with Tested Species Reactivity: Human, Mouse Predicted Species Reactivity: Human, Rat, Cow, Dog, Goat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Prnp can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PRNP prnp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGGTHNQWNK PSKPKTNLKH VAGAAAAGAV VGGLGGYMLG SAMSRPMIHF. It is sometimes possible for the material contained within the vial of "Prnp, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.