Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PRKCSH Polyclonal Antibody – Cat# AAA201251 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PRKCSH AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell.PRKCSH is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226)

Glucosidase 2 Subunit Beta Isoform 1 (PRKCSH) Antibody – Rabbit Polyclonal

PRKCSH antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PRKCSH; GIIB; PCLD; PLD1; G19P1; PCLD1; PKCSH; AGE-R2; VASAP-60
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKCSH, Antibody; PRKCSH antibody - N-terminal region; anti-PRKCSH antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KQKKLIELQAGKKSLEDQVEMLRTVKEEAEKPEREAKEQHQKLWEEQLAA
Sequence Length
528
Applicable Applications for anti-PRKCSH antibody
WB (Western Blot)
Homology
Dog: 86%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 77%; Rat: 92%; Yeast: 75%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRKCSH AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell.PRKCSH is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226)

Rabbit Anti-PRKCSH Polyclonal Antibody – Cat# AAA201251 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PRKCSH AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell.PRKCSH is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226)

WB (Western Blot)

(Host: RabbitTarget Name: PRKCSHSample Type: Human HelaAntibody Dilution: 1.0ug/mlPRKCSH is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit Anti-PRKCSH Polyclonal Antibody – Cat# AAA201251 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PRKCSHSample Type: Human HelaAntibody Dilution: 1.0ug/mlPRKCSH is supported by BioGPS gene expression data to be expressed in HeLa)

IHC (Immunohistochemistry)

(Rabbit Anti-PRKCSH antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult PlacentaObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-PRKCSH Polyclonal Antibody – Cat# AAA201251 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-PRKCSH antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult PlacentaObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PRKCSH antibody
This is a rabbit polyclonal antibody against PRKCSH. It was validated on Western Blot

Target Description: This gene encodes the beta-subunit of glucosidase II, an N-linked glycan-processing enzyme in the endoplasmic reticulum (ER). This protein is an acidic phospho-protein known to be a substrate for protein kinase C. Mutations in this gene have been associated with the autosomal dominant polycystic liver disease (PCLD). Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Product Categories/Family for anti-PRKCSH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
glucosidase 2 subunit beta isoform 1
NCBI Official Synonym Full Names
protein kinase C substrate 80K-H
NCBI Official Symbol
PRKCSH
NCBI Official Synonym Symbols
GIIB; PCLD; PLD1; G19P1; PCLD1; PKCSH; AGE-R2; VASAP-60
NCBI Protein Information
glucosidase 2 subunit beta
UniProt Protein Name
Glucosidase 2 subunit beta
UniProt Gene Name
PRKCSH
UniProt Synonym Gene Names
G19P1; PKCSH
UniProt Entry Name
GLU2B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PRKCSH prkcsh (Catalog #AAA201251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKCSH antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRKCSH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRKCSH prkcsh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQKKLIELQA GKKSLEDQVE MLRTVKEEAE KPEREAKEQH QKLWEEQLAA. It is sometimes possible for the material contained within the vial of "PRKCSH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.