Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PRKACB Polyclonal Antibody – Cat# AAA200593 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PRKACB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Camp-Dependent Protein Kinase Catalytic Subunit Beta Isoform 2 (PRKACB) Antibody – Rabbit Polyclonal

PRKACB antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PRKACB; PKACB; PKA C-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKACB, Antibody; PRKACB antibody - middle region; anti-PRKACB antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI
Sequence Length
351
Applicable Applications for anti-PRKACB antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRKACB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRKACB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Rabbit Anti-PRKACB Polyclonal Antibody – Cat# AAA200593 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PRKACB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

WB (Western Blot)

(Host: MouseTarget Name: PRKACBSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Rabbit Anti-PRKACB Polyclonal Antibody – Cat# AAA200593 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: PRKACBSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRKACB antibody
This is a rabbit polyclonal antibody against PRKACB. It was validated on Western Blot

Target Description: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase.
Product Categories/Family for anti-PRKACB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
cAMP-dependent protein kinase catalytic subunit beta isoform 2
NCBI Official Synonym Full Names
protein kinase cAMP-activated catalytic subunit beta
NCBI Official Symbol
PRKACB
NCBI Official Synonym Symbols
PKACB; PKA C-beta
NCBI Protein Information
cAMP-dependent protein kinase catalytic subunit beta
UniProt Protein Name
cAMP-dependent protein kinase catalytic subunit beta
UniProt Gene Name
PRKACB
UniProt Synonym Gene Names
PKA C-beta
UniProt Entry Name
KAPCB_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PRKACB prkacb (Catalog #AAA200593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKACB antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRKACB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRKACB prkacb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NGVSDIKTHK WFATTDWIAI YQRKVEAPFI PKFRGSGDTS NFDDYEEEDI. It is sometimes possible for the material contained within the vial of "PRKACB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.