Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PRKAA1 Polyclonal Antibody – Cat# AAA200314 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PRKAA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

5'-AMP-Activated Protein Kinase Catalytic Subunit Alpha-1 Isoform 1 (PRKAA1) Antibody – Rabbit Polyclonal

PRKAA1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PRKAA1; AMPK; AMPKa1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKAA1, Antibody; PRKAA1 antibody - middle region; anti-PRKAA1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
Sequence Length
559
Applicable Applications for anti-PRKAA1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRKAA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRKAA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

Rabbit Anti-PRKAA1 Polyclonal Antibody – Cat# AAA200314 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PRKAA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

WB (Western Blot)

(PRKAA1 antibody - middle region validated by WB using Rat liver and Mouse muscle at 1:1000.)

Rabbit Anti-PRKAA1 Polyclonal Antibody – Cat# AAA200314 – WB (Western Blot) WB (Western Blot) (PRKAA1 antibody - middle region validated by WB using Rat liver and Mouse muscle at 1:1000.)

WB (Western Blot)

(Sample Type: Rat hepatocyteSample Type:rat hepatocyte (50ug)Priamry Dilution:1:4000Secondary Antibody:Donkey anti-Rabbit HRPSecondary Dilution:1:10,000Image Submitted By:Dustin Singer,INRA/AgroParistech)

Rabbit Anti-PRKAA1 Polyclonal Antibody – Cat# AAA200314 – WB (Western Blot) WB (Western Blot) (Sample Type: Rat hepatocyteSample Type:rat hepatocyte (50ug)Priamry Dilution:1:4000Secondary Antibody:Donkey anti-Rabbit HRPSecondary Dilution:1:10,000Image Submitted By:Dustin Singer,INRA/AgroParistech)
Related Product Information for anti-PRKAA1 antibody
This is a rabbit polyclonal antibody against PRKAA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Product Categories/Family for anti-PRKAA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform 1
NCBI Official Synonym Full Names
protein kinase AMP-activated catalytic subunit alpha 1
NCBI Official Symbol
PRKAA1
NCBI Official Synonym Symbols
AMPK; AMPKa1
NCBI Protein Information
5'-AMP-activated protein kinase catalytic subunit alpha-1
UniProt Protein Name
5'-AMP-activated protein kinase catalytic subunit alpha-1
UniProt Gene Name
PRKAA1
UniProt Synonym Gene Names
AMPK1; AMPK subunit alpha-1; ACACA kinase; HMGCR kinase
UniProt Entry Name
AAPK1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PRKAA1 prkaa1 (Catalog #AAA200314) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKAA1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRKAA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRKAA1 prkaa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVISLLKHML QVDPMKRATI KDIREHEWFK QDLPKYLFPE DPSYSSTMID. It is sometimes possible for the material contained within the vial of "PRKAA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.