Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PMS2 Polyclonal Antibody – Cat# AAA200546 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PMS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysatePMS2 is supported by BioGPS gene expression data to be expressed in HepG2)

Mismatch Repair Endonuclease PMS2 Isoform A (PMS2) Antibody – Rabbit Polyclonal

PMS2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PMS2; MLH4; PMSL2; HNPCC4; PMS2CL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PMS2, Antibody; PMS2 antibody - middle region; anti-PMS2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA
Sequence Length
862
Applicable Applications for anti-PMS2 antibody
WB (Western Blot)
Homology
Cow: 85%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Rabbit: 92%; Rat: 92%; Yeast: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PMS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PMS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysatePMS2 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit Anti-PMS2 Polyclonal Antibody – Cat# AAA200546 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PMS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysatePMS2 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Sample Type: HeLa extractDilution: 1:1000)

Rabbit Anti-PMS2 Polyclonal Antibody – Cat# AAA200546 – WB (Western Blot) WB (Western Blot) (Sample Type: HeLa extractDilution: 1:1000)
Related Product Information for anti-PMS2 antibody
This is a rabbit polyclonal antibody against PMS2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.This gene is one of the PMS2 gene family members found in clusters on chromosome 7. The product of this gene is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors. Alternatively spliced transcript variants have been observed for this gene.
Product Categories/Family for anti-PMS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
mismatch repair endonuclease PMS2 isoform a
NCBI Official Synonym Full Names
PMS1 homolog 2, mismatch repair system component
NCBI Official Symbol
PMS2
NCBI Official Synonym Symbols
MLH4; PMSL2; HNPCC4; PMS2CL
NCBI Protein Information
mismatch repair endonuclease PMS2
UniProt Protein Name
Mismatch repair endonuclease PMS2
UniProt Gene Name
PMS2
UniProt Synonym Gene Names
PMSL2
UniProt Entry Name
PMS2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PMS2 pms2 (Catalog #AAA200546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PMS2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's PMS2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PMS2 pms2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: INKKVVPLDF SMSSLAKRIK QLHHEAQQSE GEQNYRKFRA KICPGENQAA. It is sometimes possible for the material contained within the vial of "PMS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.