Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23566_WB6.jpg WB (Western Blot) (WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit PIM1 Polyclonal Antibody | anti-PIM1 antibody

PIM1 antibody - N-terminal region

Gene Names
PIM1; PIM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIM1, Antibody; PIM1 antibody - N-terminal region; anti-PIM1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
Sequence Length
313
Applicable Applications for anti-PIM1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

product-image-AAA23566_WB6.jpg WB (Western Blot) (WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

WB (Western Blot)

(Host: RabbitTarget Name: PIM1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23566_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: PIM1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PIM1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA23566_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: PIM1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA23566_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: PIM1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA23566_WB2.jpg WB (Western Blot) (Host: MouseTarget Name: PIM1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA23566_WB.jpg WB (Western Blot) (Host: MouseTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-PIM1 antibody
This is a rabbit polyclonal antibody against PIM1. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
serine/threonine-protein kinase pim-1 isoform 2
NCBI Official Synonym Full Names
Pim-1 proto-oncogene, serine/threonine kinase
NCBI Official Symbol
PIM1
NCBI Official Synonym Symbols
PIM
NCBI Protein Information
serine/threonine-protein kinase pim-1
UniProt Protein Name
Serine/threonine-protein kinase pim-1
UniProt Gene Name
PIM1
UniProt Entry Name
PIM1_HUMAN

Similar Products

Product Notes

The PIM1 pim1 (Catalog #AAA23566) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIM1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PIM1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PIM1 pim1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLLSKINSLA HLRAAPCNDL HATKLAPGKE KEPLESQYQV GPLLGSGGFG. It is sometimes possible for the material contained within the vial of "PIM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.