Phosphatidylinositol N-Acetylglucosaminyltransferase Subunit A Isoform 1 (PIGA) Antibody – Rabbit Polyclonal
PIGA antibody - middle region
Gene Names
PIGA; GPI3; PNH1; PIG-A; MCAHS2
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIGA, Antibody; PIGA antibody - middle region; anti-PIGA antibody
Product Overview
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: NHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITI
Sequence Length
484
Applicable Applications for anti-PIGA antibody
WB (Western Blot)
Homology
Cow: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PIGA
Protein Size (# AA)
484 amino acids
Protein Interactions
UBC; ELAVL1; PIGY; DPM2; PIGQ; PIGH; PIGP;
Blocking Peptide
For anti-PIGA (MBS3207724) antibody is Catalog #
Preparation and Storage
For short term use, store at 2°C to 8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-PIGA antibody
This is a rabbit polyclonal antibody against PIGA. It was validated on Western Blot
Target Description: PIGA is a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene.
Target Description: PIGA is a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene.
Product Categories/Family for anti-PIGA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
phosphatidylinositol N-acetylglucosaminyltransferase subunit A isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class A
NCBI Official Symbol
PIGA
NCBI Official Synonym Symbols
GPI3; PNH1; PIG-A; MCAHS2
NCBI Protein Information
phosphatidylinositol N-acetylglucosaminyltransferase subunit A
UniProt Protein Name
Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
UniProt Gene Name
PIGA
UniProt Synonym Gene Names
PIG-A
UniProt Entry Name
PIGA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The PIGA piga (Catalog #AAA199541) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIGA antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PIGA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PIGA piga for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NHIICVSYTS KENTVLRAAL NPEIVSVIPN AVDPTDFTPD PFRRHDSITI. It is sometimes possible for the material contained within the vial of "PIGA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
