Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PHF20 Polyclonal Antibody – Cat# AAA198043 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PHF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)

PHD Finger Protein 20, Isoform CRA_B (PHF20) Antibody – Rabbit Polyclonal

PHF20 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
PHF20; NZF; TZP; GLEA2; HCA58; TDRD20A; C20orf104
Reactivity
Cow, Guinea Pig, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PHF20, Antibody; PHF20 antibody - C-terminal region; anti-PHF20 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS
Sequence Length
768
Applicable Applications for anti-PHF20 antibody
WB (Western Blot)
Homology
Cow: 92%; Guinea Pig: 83%; Horse: 83%; Human: 100%; Pig: 92%; Rabbit: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PHF20
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PHF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)

Rabbit Anti-PHF20 Polyclonal Antibody – Cat# AAA198043 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PHF20 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlPHF20 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit Anti-PHF20 Polyclonal Antibody – Cat# AAA198043 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlPHF20 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlPHF20 is strongly supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit Anti-PHF20 Polyclonal Antibody – Cat# AAA198043 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlPHF20 is strongly supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-PHF20 antibody
This is a rabbit polyclonal antibody against PHF20. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PHF20 is a possible transcription factor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
PHD finger protein 20, isoform CRA_b
NCBI Official Synonym Full Names
PHD finger protein 20
NCBI Official Symbol
PHF20
NCBI Official Synonym Symbols
NZF; TZP; GLEA2; HCA58; TDRD20A; C20orf104
NCBI Protein Information
PHD finger protein 20
UniProt Protein Name
PHD finger protein 20
UniProt Gene Name
PHF20
UniProt Synonym Gene Names
C20orf104; GLEA2; HCA58; NZF; TZP
UniProt Entry Name
PHF20_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PHF20 phf20 (Catalog #AAA198043) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHF20 antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PHF20 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PHF20 phf20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSALDDAVNP LHENGDDSLS PRLGWPLDQD RSKGDSDPKP GSPKVKEYVS. It is sometimes possible for the material contained within the vial of "PHF20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.