Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PHF11 Polyclonal Antibody – Cat# AAA197892 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PHF11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysatePHF11 is supported by BioGPS gene expression data to be expressed in HepG2)

PHD Finger Protein 11 (PHF11) Antibody – Rabbit Polyclonal

PHF11 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PHF11; APY; BCAP; IGEL; IGER; IGHER; NYREN34; NY-REN-34
Reactivity
Dog, Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PHF11, Antibody; PHF11 antibody - middle region; anti-PHF11 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF
Sequence Length
331
Applicable Applications for anti-PHF11 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 85%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PHF11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PHF11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysatePHF11 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit Anti-PHF11 Polyclonal Antibody – Cat# AAA197892 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PHF11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysatePHF11 is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohistochemistry)

(Rabbit Anti-PHF11 antibodyParaffin Embedded Tissue: Human Heartcell Cellular Data: cardiac cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-PHF11 Polyclonal Antibody – Cat# AAA197892 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-PHF11 antibodyParaffin Embedded Tissue: Human Heartcell Cellular Data: cardiac cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-PHF11 antibody
This is a rabbit polyclonal antibody against PHF11. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PHF11 contains two PHD zinc fingers and probably regulates transcription. Distinctive splice variants were expressed in immune tissues and cells.
Product Categories/Family for anti-PHF11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
PHD finger protein 11
NCBI Official Synonym Full Names
PHD finger protein 11
NCBI Official Symbol
PHF11
NCBI Official Synonym Symbols
APY; BCAP; IGEL; IGER; IGHER; NYREN34; NY-REN-34
NCBI Protein Information
PHD finger protein 11
UniProt Protein Name
PHD finger protein 11
UniProt Gene Name
PHF11
UniProt Synonym Gene Names
BCAP
UniProt Entry Name
PHF11_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PHF11 phf11 (Catalog #AAA197892) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHF11 antibody - middle region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHF11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PHF11 phf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSGVKRKRGR KKPLSGNHVQ PPETMKCNTF IRQVKEEHGR HTDATVKVPF. It is sometimes possible for the material contained within the vial of "PHF11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.