Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PEX10 Polyclonal Antibody – Cat# AAA199267 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PEX10 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Peroxisome Biogenesis Factor 10 Isoform 1 (PEX10) Antibody – Rabbit Polyclonal

PEX10 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PEX10; NALD; PBD6A; PBD6B; RNF69
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PEX10, Antibody; PEX10 antibody - middle region; anti-PEX10 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVL
Sequence Length
346
Applicable Applications for anti-PEX10 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PEX10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PEX10 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Rabbit Anti-PEX10 Polyclonal Antibody – Cat# AAA199267 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PEX10 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

IHC (Immunohistochemistry)

(Human Muscle)

Rabbit Anti-PEX10 Polyclonal Antibody – Cat# AAA199267 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-PEX10 antibody
This is a rabbit polyclonal antibody against PEX10. It was validated on Western Blot and immunohistochemistry

Target Description: PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms.
Product Categories/Family for anti-PEX10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
peroxisome biogenesis factor 10 isoform 1
NCBI Official Synonym Full Names
peroxisomal biogenesis factor 10
NCBI Official Symbol
PEX10
NCBI Official Synonym Symbols
NALD; PBD6A; PBD6B; RNF69
NCBI Protein Information
peroxisome biogenesis factor 10
UniProt Protein Name
Peroxisome biogenesis factor 10
UniProt Gene Name
PEX10
UniProt Synonym Gene Names
RNF69
UniProt Entry Name
PEX10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PEX10 pex10 (Catalog #AAA199267) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEX10 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PEX10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PEX10 pex10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QALRPDPLRV LMSVAPSALQ LRVRSLPGED LRARVSYRLL GVISLLHLVL. It is sometimes possible for the material contained within the vial of "PEX10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.