Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28441_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using PEPCK/PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit PEPCK/PCK2 Polyclonal Antibody | anti-PEPCK/PCK2 antibody

[KO Validated] PEPCK/PCK2 Rabbit pAb

Gene Names
PCK2; PEPCK; PEPCK2; PEPCK-M
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, Immunohistochemistry, Immunoprecipitation
Purity
Affinity purification
Synonyms
PEPCK/PCK2, Antibody; [KO Validated] PEPCK/PCK2 Rabbit pAb; PEPCK; PEPCK2; PEPCK-M; anti-PEPCK/PCK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAALYRPGLRLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVQLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLA
Applicable Applications for anti-PEPCK/PCK2 antibody
Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP)
Application Notes
WB: 1:500-1:1000
IF/ICC: 1:50-1:200
IHC-P: 1:50-1:200
IP: 1:50-1:200
Positive Samples
293T, SH-SY5Y, HepG2
Cellular Location
Mitochondrion
Research Area
Cancer, Signal Transduction, Kinase, Endocrine Metabolism, Mitochondrial metabolism, Mitochondrial markers, Lipid Metabolism, Cholesterol Metabolism, Carbohydrate metabolism, Endocrine and metabolic diseases, Obesity, Cardiovascular, Lipids
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PEPCK/PCK2 (NP_004554.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using PEPCK/PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28441_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using PEPCK/PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using PEPCK/PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28441_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using PEPCK/PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded mouse kidney using [KO Validated] PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

product-image-AAA28441_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded mouse kidney using [KO Validated] PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded rat kidney using [KO Validated] PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

product-image-AAA28441_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded rat kidney using [KO Validated] PEPCK/PCK2 Rabbit pAb (AAA28441) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.)

IP (Immunoprecipitation)

(Immunoprecipitation analysis of extracts of HepG2 cells using PEPCK/PEPCK/PCK2 antibody (AAA28441). Western blot was performed from the immunoprecipitate using PEPCK/PEPCK/PCK2 antibody (AAA28441) at a dilution of 1:1000.)

product-image-AAA28441_IP2.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of extracts of HepG2 cells using PEPCK/PEPCK/PCK2 antibody (AAA28441). Western blot was performed from the immunoprecipitate using PEPCK/PEPCK/PCK2 antibody (AAA28441) at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of various lysates, using PEPCK/PCK2 Rabbit pAb antibody (AAA28441) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)

product-image-AAA28441_WB.jpg WB (Western Blot) (Western blot analysis of various lysates, using PEPCK/PCK2 Rabbit pAb antibody (AAA28441) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)
Related Product Information for anti-PEPCK/PCK2 antibody
This gene encodes a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of guanosine triphosphate (GTP). A cytosolic form of this protein is encoded by a different gene and is the key enzyme of gluconeogenesis in the liver. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-PEPCK/PCK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,564 Da
NCBI Official Full Name
phosphoenolpyruvate carboxykinase
NCBI Official Synonym Full Names
phosphoenolpyruvate carboxykinase 2 (mitochondrial)
NCBI Official Symbol
PCK2
NCBI Official Synonym Symbols
PEPCK; PEPCK2; PEPCK-M
NCBI Protein Information
phosphoenolpyruvate carboxykinase [GTP], mitochondrial; phosphoenolpyruvate carboxykinase [GTP], mitochondrial; PEP carboxykinase; phosphopyruvate carboxylase
UniProt Protein Name
Phosphoenolpyruvate carboxykinase [GTP], mitochondrial
UniProt Gene Name
PCK2
UniProt Synonym Gene Names
PEPCK2; PEPCK-M
UniProt Entry Name
PCKGM_HUMAN

Similar Products

Product Notes

The PEPCK/PCK2 pck2 (Catalog #AAA28441) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] PEPCK/PCK2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PEPCK/PCK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP). WB: 1:500-1:1000 IF/ICC: 1:50-1:200 IHC-P: 1:50-1:200 IP: 1:50-1:200. Researchers should empirically determine the suitability of the PEPCK/PCK2 pck2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAALYRPGLR LNWHGLSPLG WPSCRSIQTL RVLSGDLGQL PTGIRDFVEH SARLCQPEGI HICDGTEAEN TATLTLLEQQ GLIRKLPKYN NCWLARTDPK DVARVESKTV IVTPSQRDTV QLPPGGARGQ LGNWMSPADF QRAVDERFPG CMQGRTMYVL PFSMGPVGSP LSRIGVQLTD SAYVVASMRI MTRLGTPVLQ ALGDGDFVKC LHSVGQPLTG QGEPVSQWPC NPEKTLIGHV PDQREIISFG SGYGGNSLLG KKCFALRIAS RLARDEGWLA. It is sometimes possible for the material contained within the vial of "PEPCK/PCK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.