Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23582_APP7.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown)

Rabbit PDGFB Polyclonal Antibody | anti-PDGFB antibody

PDGFB antibody - N-terminal region

Gene Names
PDGFB; SIS; SSV; IBGC5; PDGF2; c-sis; PDGF-2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PDGFB, Antibody; PDGFB antibody - N-terminal region; anti-PDGFB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD
Sequence Length
241
Applicable Applications for anti-PDGFB antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFB
Protein Size (#AA)
241 amino acids
Protein Interactions
COL6A1; COL5A1; COL4A1; COL3A1; COL2A1; COL1A2; COL1A1; LYVE1; NRP1; ADIPOQ; MDFI; PDAP1; ART1; PDGFB; HRAS; THBS1; PDGFRA; PDGFRB; HSPG2; LRP1; A2M; SPARC;
Sample Type Confirmation
There is BioGPS gene expression data showing that PDGFB is expressed in HEK293T
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown)

product-image-AAA23582_APP7.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown)

WB (Western Blot)

(WB Suggested Anti-PDGFB antibody Titration: 1 ug/mLSample Type: Human liver)

product-image-AAA23582_WB6.jpg WB (Western Blot) (WB Suggested Anti-PDGFB antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(WB Suggested Anti-PDGFB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that PDGFB is expressed in HEK293T)

product-image-AAA23582_WB5.jpg WB (Western Blot) (WB Suggested Anti-PDGFB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that PDGFB is expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: PDGFBSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23582_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: PDGFBSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDGFBSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23582_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: PDGFBSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-PDGFB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA23582_IHC2.jpg IHC (Immunohistochemistry) (Rabbit Anti-PDGFB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

IHC (Immunohistochemistry)

(Immunohistochemistry with Uterus tissue at an antibody concentration of 5ug/ml using anti-PDGFB antibody)

product-image-AAA23582_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Uterus tissue at an antibody concentration of 5ug/ml using anti-PDGFB antibody)
Related Product Information for anti-PDGFB antibody
This is a rabbit polyclonal antibody against PDGFB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two splice variants have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
platelet-derived growth factor subunit B isoform 1 preproprotein
NCBI Official Synonym Full Names
platelet derived growth factor subunit B
NCBI Official Symbol
PDGFB
NCBI Official Synonym Symbols
SIS; SSV; IBGC5; PDGF2; c-sis; PDGF-2
NCBI Protein Information
platelet-derived growth factor subunit B
UniProt Protein Name
Platelet-derived growth factor subunit B
UniProt Gene Name
PDGFB
UniProt Synonym Gene Names
PDGF2; SIS; PDGF subunit B
UniProt Entry Name
PDGFB_HUMAN

Similar Products

Product Notes

The PDGFB pdgfb (Catalog #AAA23582) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDGFB antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PDGFB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the PDGFB pdgfb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NRCWALFLSL CCYLRLVSAE GDPIPEELYE MLSDHSIRSF DDLQRLLHGD. It is sometimes possible for the material contained within the vial of "PDGFB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.