Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PAX3 Polyclonal Antibody – Cat# AAA197448 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PAX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Paired Box Protein Pax-3 Isoform PAX3 (PAX3) Antibody – Rabbit Polyclonal

PAX3 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
PAX3; WS1; WS3; CDHS; HUP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish (Tested Reactivity: Human, Mouse)
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PAX3, Antibody; PAX3 antibody - C-terminal region; anti-PAX3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish (Tested Reactivity: Human, Mouse)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC
Sequence Length
479
Applicable Applications for anti-PAX3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PAX3.
Protein Size
479 amino acids
Protein Interactions
PCTP; UBC; TAF1; POU3F2; HDAC1; TRIM28; HDAC10; SOX8; WWTR1; PAX3; DAXX; CIB1; SOX10; MEOX2; MEOX1; MITF; MSX1; Rad23b; PSMD4; TBP; IPO13; CNR1;
Replacement Item
This antibody may replace item sc-25409 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PAX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Rabbit Anti-PAX3 Polyclonal Antibody – Cat# AAA197448 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PAX3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

WB (Western Blot)

(WB Suggested Anti-PAX3 AntibodyPositive Control: Lane 1: DYKDDDDK-PAX3(overexpression, human), HEK293, 50?g. Lane 2: Mouse, B16F10, 50?g. Lane 3: Human, A375, 50?g. Lane 4: Human, A2058, 50?gPrimary Antibody Dilution : 1:5000Secondary Antibody : Goat anti-rabbit APSecondry Antibody Dilution : 1:5000Submitted by: Tsu Fang Wu, Institute of Molecular Biology, National Chung Hsing University)

Rabbit Anti-PAX3 Polyclonal Antibody – Cat# AAA197448 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PAX3 AntibodyPositive Control: Lane 1: DYKDDDDK-PAX3(overexpression, human), HEK293, 50?g. Lane 2: Mouse, B16F10, 50?g. Lane 3: Human, A375, 50?g. Lane 4: Human, A2058, 50?gPrimary Antibody Dilution : 1:5000Secondary Antibody : Goat anti-rabbit APSecondry Antibody Dilution : 1:5000Submitted by: Tsu Fang Wu, Institute of Molecular Biology, National Chung Hsing University)

IHC (Immunohistochemistry)

(Sample Type :Mouse B16F10Primary Antibody Dilution :1:200Secondary Antibody :Goat anti-rabbit-FITCSecondary Antibody Dilution :1:800Color/Signal Descriptions :Green: FITC Blue: DAPIGene Name :PAX3Submitted by :Tsu Fang Wu, Institute of Molecular Biology, National Chung Hsing University)

Rabbit Anti-PAX3 Polyclonal Antibody – Cat# AAA197448 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type :Mouse B16F10Primary Antibody Dilution :1:200Secondary Antibody :Goat anti-rabbit-FITCSecondary Antibody Dilution :1:800Color/Signal Descriptions :Green: FITC Blue: DAPIGene Name :PAX3Submitted by :Tsu Fang Wu, Institute of Molecular Biology, National Chung Hsing University)
Related Product Information for anti-PAX3 antibody
This is a rabbit polyclonal antibody against PAX3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PAX3 is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma.This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
paired box protein Pax-3 isoform PAX3
NCBI Official Synonym Full Names
paired box 3
NCBI Official Symbol
PAX3
NCBI Official Synonym Symbols
WS1; WS3; CDHS; HUP2
NCBI Protein Information
paired box protein Pax-3
UniProt Protein Name
Paired box protein Pax-3
UniProt Gene Name
PAX3
UniProt Synonym Gene Names
HUP2
UniProt Entry Name
PAX3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PAX3 pax3 (Catalog #AAA197448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAX3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish (Tested Reactivity: Human, Mouse) and may cross-react with other species as described in the data sheet. AAA Biotech's PAX3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PAX3 pax3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGVPHQPQTD YALSPLTGGL EPTTTVSASC SQRLDHMKSL DSLPTSQSYC. It is sometimes possible for the material contained within the vial of "PAX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.