Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PARD6B Polyclonal Antibody – Cat# AAA199197 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Pard6b antibody Titration: 1 ug/mLSample Type: Human liver)

Partitioning Defective 6 Homolog Beta (PARD6B) Antibody – Rabbit Polyclonal

Pard6b Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Pard6b; Par6b; AV025615
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Pard6b, Antibody; Pard6b Antibody - N-terminal region; anti-PARD6B antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL
Sequence Length
371
Applicable Applications for anti-PARD6B antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Pard6b
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Pard6b antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit Anti-PARD6B Polyclonal Antibody – Cat# AAA199197 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-Pard6b antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(Host: RabbitTarget Name: Pard6bSample Type: Mouse Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-PARD6B Polyclonal Antibody – Cat# AAA199197 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: Pard6bSample Type: Mouse Heart lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: PARD6GSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Rabbit Anti-PARD6B Polyclonal Antibody – Cat# AAA199197 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: PARD6GSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-Pard6b AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Cytoplasmic,MembranePrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit Anti-PARD6B Polyclonal Antibody – Cat# AAA199197 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-Pard6b AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: Cytoplasmic,MembranePrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-PARD6B antibody
This is a rabbit polyclonal antibody against Pard6b. It was validated on Western Blot

Target Description: Pard6b is a adapter protein involved in asymmetrical cell division and cell polarization processes. It is probably involved in formation of epithelial tight junctions. Association with PARD3 may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins.
Product Categories/Family for anti-PARD6B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
partitioning defective 6 homolog beta
NCBI Official Synonym Full Names
par-6 family cell polarity regulator beta
NCBI Official Symbol
Pard6b
NCBI Official Synonym Symbols
Par6b; AV025615
NCBI Protein Information
partitioning defective 6 homolog beta
UniProt Protein Name
Partitioning defective 6 homolog beta
UniProt Gene Name
Pard6b
UniProt Synonym Gene Names
Par6b; PAR-6 beta; PAR-6B
UniProt Entry Name
PAR6B_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PARD6B pard6b (Catalog #AAA199197) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pard6b Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Pard6b can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PARD6B pard6b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SKFGAEFRRF SLERSKPGKF EEFYGLLQHV HKIPNVDVLV GYADIHGDLL. It is sometimes possible for the material contained within the vial of "Pard6b, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.