Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-P2RX1 Polyclonal Antibody – Cat# AAA197918 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-P2RX1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

P2X Purinoceptor 1 (P2RX1) Antibody – Rabbit Polyclonal

P2RX1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
P2RX1; P2X1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
P2RX1, Antibody; P2RX1 antibody - middle region; anti-P2RX1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
Sequence Length
399
Applicable Applications for anti-P2RX1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human P2RX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-P2RX1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit Anti-P2RX1 Polyclonal Antibody – Cat# AAA197918 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-P2RX1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human Pancreas)

Rabbit Anti-P2RX1 Polyclonal Antibody – Cat# AAA197918 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Pancreas)
Related Product Information for anti-P2RX1 antibody
This is a rabbit polyclonal antibody against P2RX1. It was validated on Western Blot and immunohistochemistry

Target Description: P2RX1 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill.The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
P2X purinoceptor 1
NCBI Official Synonym Full Names
purinergic receptor P2X 1
NCBI Official Symbol
P2RX1
NCBI Official Synonym Symbols
P2X1
NCBI Protein Information
P2X purinoceptor 1
UniProt Protein Name
P2X purinoceptor 1
UniProt Gene Name
P2RX1
UniProt Synonym Gene Names
P2X1; P2X1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The P2RX1 p2rx1 (Catalog #AAA197918) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RX1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's P2RX1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the P2RX1 p2rx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVGITIDWHC DLDWHVRHCR PIYEFHGLYE EKNLSPGFNF RFARHFVENG. It is sometimes possible for the material contained within the vial of "P2RX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.