NPC1-Like Intracellular Cholesterol Transporter 1 Isoform 2 (NPC1L1) Antibody – Rabbit Polyclonal
NPC1L1 Antibody - N-terminal region
Gene Names
NPC1L1; LDLCQ7; NPC11L1; SLC65A2
Reactivity
Tested Reactivity: Human (Predicted Reactivity: Human)
Applications
Western Blot
Purity
Affinity purified
Synonyms
NPC1L1, Antibody; NPC1L1 Antibody - N-terminal region; anti-NPC1L1 antibody
Product Overview
Host
Rabbit
Reactivity
Tested Reactivity: Human (Predicted Reactivity: Human)
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5 - 1 mg (varies by lot)
Sequence
Synthetic peptide located within the following region: YGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGVA
Sequence Length
1359
Applicable Applications for anti-NPC1L1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPCL1
Protein Size (#aa)
1359 amino acids
Protein Interaction
LGR4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-NPC1L1 antibody
This is a rabbit polyclonal antibody against NPCL1. It was validated on Western Blot
Target Description: The protein encoded by this gene is a multi-pass membrane protein. It contains a conserved N-terminal Niemann-Pick C1 (NPC1) domain and a putative sterol-sensing domain (SSD) which includes a YQRL motif functioning as a plasma membrane to trans-Golgi network transport signal in other proteins. This protein takes up free cholesterol into cells through vesicular endocytosis and plays a critical role in the absorption of intestinal cholesterol. It also has the ability to transport alpha-tocopherol (vitamin E). The drug ezetimibe targets this protein and inhibits the absorption of intestinal cholesterol and alpha-tocopherol. In addition, this protein may play a critical role in regulating lipid metabolism. Polymorphic variations in this gene are associated with plasma total cholesterol and low-density lipoprotein cholesterol (LDL-C) levels and coronary heart disease (CHD) risk. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Target Description: The protein encoded by this gene is a multi-pass membrane protein. It contains a conserved N-terminal Niemann-Pick C1 (NPC1) domain and a putative sterol-sensing domain (SSD) which includes a YQRL motif functioning as a plasma membrane to trans-Golgi network transport signal in other proteins. This protein takes up free cholesterol into cells through vesicular endocytosis and plays a critical role in the absorption of intestinal cholesterol. It also has the ability to transport alpha-tocopherol (vitamin E). The drug ezetimibe targets this protein and inhibits the absorption of intestinal cholesterol and alpha-tocopherol. In addition, this protein may play a critical role in regulating lipid metabolism. Polymorphic variations in this gene are associated with plasma total cholesterol and low-density lipoprotein cholesterol (LDL-C) levels and coronary heart disease (CHD) risk. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NPC1L1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
149kDa
NCBI Official Full Name
NPC1-like intracellular cholesterol transporter 1 isoform 2
NCBI Official Synonym Full Names
NPC1 like intracellular cholesterol transporter 1
NCBI Official Symbol
NPC1L1
NCBI Official Synonym Symbols
LDLCQ7; NPC11L1; SLC65A2
NCBI Protein Information
NPC1-like intracellular cholesterol transporter 1
UniProt Protein Name
Niemann-Pick C1-like protein 1
UniProt Gene Name
NPC1L1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The NPC1L1 npc1l1 (Catalog #AAA201532) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPC1L1 Antibody - N-terminal region reacts with Tested Reactivity: Human (Predicted Reactivity: Human) and may cross-react with other species as described in the data sheet. AAA Biotech's NPC1L1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NPC1L1 npc1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGSALCNAQR WLNFQGDTGN GLAPLDITFH LLEPGQAVGS GIQPLNEGVA. It is sometimes possible for the material contained within the vial of "NPC1L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
