Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-NPAS1 Polyclonal Antibody – Cat# AAA197279 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NPAS1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateNPAS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Neuronal PAS Domain-Containing Protein 1 Isoform 1 (NPAS1) Antibody – Rabbit Polyclonal

NPAS1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
NPAS1; MOP5; PASD5; bHLHe11
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NPAS1, Antibody; NPAS1 antibody - C-terminal region; anti-NPAS1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
Sequence Length
590
Applicable Applications for anti-NPAS1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NPAS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NPAS1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateNPAS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit Anti-NPAS1 Polyclonal Antibody – Cat# AAA197279 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NPAS1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateNPAS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Human Stomach)

Rabbit Anti-NPAS1 Polyclonal Antibody – Cat# AAA197279 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Stomach)
Related Product Information for anti-NPAS1 antibody
This is a rabbit polyclonal antibody against NPAS1. It was validated on Western Blot and immunohistochemistry

Target Description: NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
neuronal PAS domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
neuronal PAS domain protein 1
NCBI Official Symbol
NPAS1
NCBI Official Synonym Symbols
MOP5; PASD5; bHLHe11
NCBI Protein Information
neuronal PAS domain-containing protein 1
UniProt Protein Name
Neuronal PAS domain-containing protein 1
UniProt Gene Name
NPAS1
UniProt Synonym Gene Names
BHLHE11; MOP5; PASD5; Neuronal PAS1; bHLHe11
UniProt Entry Name
NPAS1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The NPAS1 npas1 (Catalog #AAA197279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPAS1 antibody - C-terminal region reacts with Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NPAS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NPAS1 npas1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIRYGPAELG LVYPHLQRLG PGPALPEAFY PPLGLPYPGP AGTRLPRKGD. It is sometimes possible for the material contained within the vial of "NPAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.