Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-NLRP3 Polyclonal Antibody – Cat# AAA201177 – Application Data Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

NACHT, LRR And PYD Domains-Containing Protein 3 Isoform A (NLRP3) Antibody – Rabbit Polyclonal

NLRP3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
NLRP3; AII; AVP; FCU; MWS; FCAS; KEFH; CIAS1; FCAS1; NALP3; C1orf7; CLR1.1; DFNA34; PYPAF1; AGTAVPRL
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NLRP3, Antibody; NLRP3 antibody - N-terminal region; anti-NLRP3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LGESVSLNKRYTRLRLIKEHRSQQEREQELLAIGKTKTCESPVSPIKMEL
Sequence Length
1036
Applicable Applications for anti-NLRP3 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 79%
Protein Size (# AA)
1036 amino acids
Protein Interactions
DHX33; FAF1; SUGT1; HSP90AA1; CARD8; PYCARD; NLRC4;
Blocking Peptide
For anti-NLRP3 (MBS3215955) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

Rabbit Anti-NLRP3 Polyclonal Antibody – Cat# AAA201177 – Application Data Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

WB (Western Blot)

(WB Suggested Anti-NLRP3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Rabbit Anti-NLRP3 Polyclonal Antibody – Cat# AAA201177 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NLRP3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

WB (Western Blot)

(Lanes:Lane 1: 30ug human glioma lysateLane 2: 30ug IL-1 treated human glioma lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:NLRP3Submitted by:Anonymous)

Rabbit Anti-NLRP3 Polyclonal Antibody – Cat# AAA201177 – WB (Western Blot) WB (Western Blot) (Lanes:Lane 1: 30ug human glioma lysateLane 2: 30ug IL-1 treated human glioma lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:NLRP3Submitted by:Anonymous)
Related Product Information for anti-NLRP3 antibody
This is a rabbit polyclonal antibody against NLRP3. It was validated on Western Blot

Target Description: This gene encodes a pyrin-like protein containing a pyrin domain, a nucleotide-binding site (NBS) domain, and a leucine-rich repeat (LRR) motif. This protein interacts with the apoptosis-associated speck-like protein PYCARD/ASC, which contains a caspase recruitment domain, and is a member of the NALP3 inflammasome complex. This complex functions as an upstream activator of NF-kappaB signaling, and it plays a role in the regulation of inflammation, the immune response, and apoptosis. Mutations in this gene are associated with familial cold autoinflammatory syndrome (FCAS), Muckle-Wells syndrome (MWS), chronic infantile neurological cutaneous and articular (CINCA) syndrome, and neonatal-onset multisystem inflammatory disease (NOMID).
Product Categories/Family for anti-NLRP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114kDa
NCBI Official Full Name
NACHT, LRR and PYD domains-containing protein 3 isoform a
NCBI Official Synonym Full Names
NLR family pyrin domain containing 3
NCBI Official Symbol
NLRP3
NCBI Official Synonym Symbols
AII; AVP; FCU; MWS; FCAS; KEFH; CIAS1; FCAS1; NALP3; C1orf7; CLR1.1; DFNA34; PYPAF1; AGTAVPRL
NCBI Protein Information
NACHT, LRR and PYD domains-containing protein 3
UniProt Protein Name
NACHT, LRR and PYD domains-containing protein 3
UniProt Gene Name
NLRP3
UniProt Synonym Gene Names
C1orf7; CIAS1; NALP3; PYPAF1; CLR1.1
UniProt Entry Name
NALP3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The NLRP3 nlrp3 (Catalog #AAA201177) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRP3 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's NLRP3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NLRP3 nlrp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGESVSLNKR YTRLRLIKEH RSQQEREQEL LAIGKTKTCE SPVSPIKMEL. It is sometimes possible for the material contained within the vial of "NLRP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.