WB (Western Blot)
(WB Suggested Anti-NFYC Antibody Titration: 0.25 ug/mlPositive Control: 293T cells lysateThere is BioGPS gene expression data showing that NFYC is expressed in HEK293T)
Rabbit NFYC Polyclonal Antibody | anti-NFYC antibody
NFYC antibody - C-terminal region
Gene Names
NFYC; HSM; CBFC; HAP5; CBF-C; NF-YC; H1TF2A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NFYC, Antibody; NFYC antibody - C-terminal region; anti-NFYC antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPA
Sequence Length
335
Applicable Applications for anti-NFYC antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NFYC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NFYC Antibody Titration: 0.25 ug/mlPositive Control: 293T cells lysateThere is BioGPS gene expression data showing that NFYC is expressed in HEK293T)
WB (Western Blot)
(WB Suggested Anti-NFYC Antibody Titration: 0.25 ug/mlPositive Control: 293T cells lysateThere is BioGPS gene expression data showing that NFYC is expressed in HEK293T)
WB (Western Blot)
(Host: MouseTarget Name: NFYCSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: NFYCSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Human Liver)
IHC (Immunohistochemistry)
(Human Liver)
Related Product Information for anti-NFYC antibody
This is a rabbit polyclonal antibody against NFYC. It was validated on Western Blot and immunohistochemistry
Target Description: NFYC is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. NFYC forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity.The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. Additional regulation, preliminarily supported by the EST database, may be represented by alternative splicing in this subunit.
Target Description: NFYC is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. NFYC forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity.The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. Additional regulation, preliminarily supported by the EST database, may be represented by alternative splicing in this subunit.
Product Categories/Family for anti-NFYC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
nuclear transcription factor Y subunit gamma isoform 3
NCBI Official Synonym Full Names
nuclear transcription factor Y subunit gamma
NCBI Official Symbol
NFYC
NCBI Official Synonym Symbols
HSM; CBFC; HAP5; CBF-C; NF-YC; H1TF2A
NCBI Protein Information
nuclear transcription factor Y subunit gamma
UniProt Protein Name
Nuclear transcription factor Y subunit gamma
UniProt Gene Name
NFYC
UniProt Synonym Gene Names
NF-YC
UniProt Entry Name
NFYC_HUMAN
Similar Products
Product Notes
The NFYC nfyc (Catalog #AAA198436) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFYC antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NFYC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NFYC nfyc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTQVVQGQIQ TLATNAQQIT QTEVQQGQQQ FSQFTDGQQL YQIQQVTMPA. It is sometimes possible for the material contained within the vial of "NFYC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.