Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-NFATC3 Polyclonal Antibody – Cat# AAA23612 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NFATC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Nuclear Factor Of Activated T-Cells, Cytoplasmic 3 Isoform 2 (NFATC3) Antibody – Rabbit Polyclonal

NFATC3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
NFATC3; NFAT4; NFATX; NF-AT4c
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NFATC3, Antibody; NFATC3 antibody - N-terminal region; anti-NFATC3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI
Sequence Length
1068
Applicable Applications for anti-NFATC3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NFATC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Rabbit Anti-NFATC3 Polyclonal Antibody – Cat# AAA23612 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NFATC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: NFATC3Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-NFATC3 Polyclonal Antibody – Cat# AAA23612 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: NFATC3Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: NFATC3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit Anti-NFATC3 Polyclonal Antibody – Cat# AAA23612 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: NFATC3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: NFATC3Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit Anti-NFATC3 Polyclonal Antibody – Cat# AAA23612 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: NFATC3Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-NFATC3 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-NFATC3 Polyclonal Antibody – Cat# AAA23612 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-NFATC3 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-NFATC3 antibody)

Rabbit Anti-NFATC3 Polyclonal Antibody – Cat# AAA23612 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-NFATC3 antibody)
Related Product Information for anti-NFATC3 antibody
This is a rabbit polyclonal antibody against NFATC3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFATC3 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. NFATC3 plays a role in the regulation of gene expression in T cells and immature thymocytes.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115kDa
NCBI Official Full Name
nuclear factor of activated T-cells, cytoplasmic 3 isoform 2
NCBI Official Synonym Full Names
nuclear factor of activated T cells 3
NCBI Official Symbol
NFATC3
NCBI Official Synonym Symbols
NFAT4; NFATX; NF-AT4c
NCBI Protein Information
nuclear factor of activated T-cells, cytoplasmic 3

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The NFATC3 (Catalog #AAA23612) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFATC3 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NFATC3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVFPFQYCVE TDIPLKTRKT SEDQAAILPG KLELCSDDQG SLSPARETSI. It is sometimes possible for the material contained within the vial of "NFATC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.