Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-NFATC2 Polyclonal Antibody – Cat# AAA198423 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NFATC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 Isoform C (NFATC2) Antibody – Rabbit Polyclonal

NFATC2 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
NFATC2; NFAT1; NFATP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NFATC2, Antibody; NFATC2 antibody - C-terminal region; anti-NFATC2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE
Sequence Length
925
Applicable Applications for anti-NFATC2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NFATC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NFATC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit Anti-NFATC2 Polyclonal Antibody – Cat# AAA198423 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NFATC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: NFATC2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Rabbit Anti-NFATC2 Polyclonal Antibody – Cat# AAA198423 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: NFATC2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-NFATC2 antibody)

Rabbit Anti-NFATC2 Polyclonal Antibody – Cat# AAA198423 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-NFATC2 antibody)
Related Product Information for anti-NFATC2 antibody
This is a rabbit polyclonal antibody against NFATC2. It was validated on Western Blot

Target Description: This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100kDa
NCBI Official Full Name
nuclear factor of activated T-cells, cytoplasmic 2 isoform C
NCBI Official Synonym Full Names
nuclear factor of activated T cells 2
NCBI Official Symbol
NFATC2
NCBI Official Synonym Symbols
NFAT1; NFATP
NCBI Protein Information
nuclear factor of activated T-cells, cytoplasmic 2
UniProt Protein Name
Nuclear factor of activated T-cells, cytoplasmic 2
UniProt Gene Name
NFATC2
UniProt Synonym Gene Names
NFAT1; NFATP; NF-ATc2; NFATc2; NF-ATp
UniProt Entry Name
NFAC2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The NFATC2 nfatc2 (Catalog #AAA198423) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFATC2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NFATC2 nfatc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTVIQQQNAT SQRAAKNGPP VSDQKEVLPA GVTIKQEQNL DQTYLDDVNE. It is sometimes possible for the material contained within the vial of "NFATC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.