Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198383_WB13.jpg WB (Western Blot) (WB Suggested Anti-NFATC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit NFATC1 Polyclonal Antibody | anti-NFATC1 antibody

NFATC1 antibody - N-terminal region

Gene Names
NFATC1; NFAT2; NFATc; NF-ATC; NF-ATc1.2
Reactivity
Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NFATC1, Antibody; NFATC1 antibody - N-terminal region; anti-NFATC1 antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSN
Sequence Length
716
Applicable Applications for anti-NFATC1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NFATC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

product-image-AAA198383_WB13.jpg WB (Western Blot) (WB Suggested Anti-NFATC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

IHC (Immunohistochemistry)

(Rabbit Anti-NFATC1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic,Nuclear (nuclear membrane)Primary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA198383_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-NFATC1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic,Nuclear (nuclear membrane)Primary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-NFATC1 antibody
This is a rabbit polyclonal antibody against NFATC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes. The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Five transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
nuclear factor of activated T-cells, cytoplasmic 1 isoform A
NCBI Official Synonym Full Names
nuclear factor of activated T cells 1
NCBI Official Symbol
NFATC1
NCBI Official Synonym Symbols
NFAT2; NFATc; NF-ATC; NF-ATc1.2
NCBI Protein Information
nuclear factor of activated T-cells, cytoplasmic 1
UniProt Protein Name
Nuclear factor of activated T-cells, cytoplasmic 1
UniProt Gene Name
NFATC1
UniProt Synonym Gene Names
NFAT2; NFATC; NF-ATc1; NFATc1; NF-ATc; NFATc
UniProt Entry Name
NFAC1_HUMAN

Similar Products

Product Notes

The NFATC1 nfatc1 (Catalog #AAA198383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFATC1 antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NFATC1 nfatc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSTSFPVPSK FPLGPAAAVF GRGETLGPAP RAGGTMKSAE EEHYGYASSN. It is sometimes possible for the material contained within the vial of "NFATC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.