Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-NEU1 Polyclonal Antibody – Cat# AAA199417 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NEU1 Antibody Titration: 5.0ug/mlPositive Control: Fetal Pancreas cell lysate)

Sialidase-1 (NEU1) Antibody – Rabbit Polyclonal

NEU1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
NEU1; NEU; NANH; SIAL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
NEU1, Antibody; NEU1 antibody - middle region; anti-NEU1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
Sequence Length
415
Applicable Applications for anti-NEU1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NEU1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NEU1 Antibody Titration: 5.0ug/mlPositive Control: Fetal Pancreas cell lysate)

Rabbit Anti-NEU1 Polyclonal Antibody – Cat# AAA199417 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-NEU1 Antibody Titration: 5.0ug/mlPositive Control: Fetal Pancreas cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: NEU1Sample Tissue: Human ACHNAntibody Dilution: 1.0ug/ml)

Rabbit Anti-NEU1 Polyclonal Antibody – Cat# AAA199417 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: NEU1Sample Tissue: Human ACHNAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Human Muscle)

Rabbit Anti-NEU1 Polyclonal Antibody – Cat# AAA199417 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-NEU1 antibody
This is a rabbit polyclonal antibody against NEU1. It was validated on Western Blot and immunohistochemistry

Target Description: NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.The protein encoded by this gene encodes the lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
sialidase-1
NCBI Official Synonym Full Names
neuraminidase 1
NCBI Official Symbol
NEU1
NCBI Official Synonym Symbols
NEU; NANH; SIAL1
NCBI Protein Information
sialidase-1
UniProt Protein Name
Sialidase-1
UniProt Gene Name
NEU1
UniProt Synonym Gene Names
NANH
UniProt Entry Name
NEUR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The NEU1 neu1 (Catalog #AAA199417) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEU1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NEU1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NEU1 neu1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VWSKDDGVSW STPRNLSLDI GTEVFAPGPG SGIQKQREPR KGRLIVCGHG. It is sometimes possible for the material contained within the vial of "NEU1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.