Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23597_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: NADSYN1Sample Tissue: Human HCT116 Whole Cell Antibody Dilution: 1ug/ml)

Rabbit NADSYN1 Polyclonal Antibody | anti-NADSYN1 antibody

NADSYN1 Antibody - C-terminal region

Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NADSYN1, Antibody; NADSYN1 Antibody - C-terminal region; anti-NADSYN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG
Applicable Applications for anti-NADSYN1 antibody
WB (Western Blot)
Protein Size (# AA)
706 amino acids
Protein Interactions
MYO15B; STUB1; AIP; UPF1; UBC; UBD; NADSYN1; CUTC;
Blocking Peptide
For anti-NADSYN1 antibody
Predicted Homology
Based on Immunogen Sequence Cow: 86%; Dog: 86%; Goat: 85%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93%; Yeast: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NADSYN1
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: NADSYN1Sample Tissue: Human HCT116 Whole Cell Antibody Dilution: 1ug/ml)

product-image-AAA23597_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: NADSYN1Sample Tissue: Human HCT116 Whole Cell Antibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NADSYN1Sample Tissue: Human 786-0 Whole Cell Antibody Dilution: 1ug/ml)

product-image-AAA23597_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: NADSYN1Sample Tissue: Human 786-0 Whole Cell Antibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: Rabbit Target Name: NADSYN1 Sample Tissue: Human HT1080 Whole Cell Antibody Dilution: 1ug/ml)

product-image-AAA23597_WB4.jpg WB (Western Blot) (Host: Rabbit Target Name: NADSYN1 Sample Tissue: Human HT1080 Whole Cell Antibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NADSYN1Sample Tissue: Human HCT116 Whole Cell Antibody Dilution: 3ug/ml)

product-image-AAA23597_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: NADSYN1Sample Tissue: Human HCT116 Whole Cell Antibody Dilution: 3ug/ml)

WB (Western Blot)

(Host: RabbitTarget: NADSYN1Positive control (+): MCF7 Cell Lysate (N10)Negative control (-): HepG2 Cell Lysate (HG)Antibody concentration: 3ug/ml)

product-image-AAA23597_WB2.jpg WB (Western Blot) (Host: RabbitTarget: NADSYN1Positive control (+): MCF7 Cell Lysate (N10)Negative control (-): HepG2 Cell Lysate (HG)Antibody concentration: 3ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NADSYN1Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA23597_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: NADSYN1Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NADSYN1 antibody
This is a rabbit polyclonal antibody against NADSYN1. It was validated on Western Blot

Target Description: Nicotinamide adenine dinucleotide (NAD) is a coenzyme in metabolic redox reactions, a precursor for several cell signaling molecules, and a substrate for protein posttranslational modifications. NAD synthetase (EC 6.3.5.1) catalyzes the final step in the biosynthesis of NAD from nicotinic acid adenine dinucleotide (NaAD).
Product Categories/Family for anti-NADSYN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
glutamine-dependent NAD(+) synthetase
NCBI Official Synonym Full Names
NAD synthetase 1
NCBI Official Symbol
NADSYN1
NCBI Protein Information
glutamine-dependent NAD(+) synthetase
UniProt Protein Name
Glutamine-dependent NAD(+) synthetase
UniProt Gene Name
NADSYN1
UniProt Entry Name
NADE_HUMAN

Similar Products

Product Notes

The NADSYN1 nadsyn1 (Catalog #AAA23597) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NADSYN1 Antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's NADSYN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NADSYN1 nadsyn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PAYHAENYSP EDNRFDLRPF LYNTSWPWQF RCIENQVLQL ERAEPQSLDG. It is sometimes possible for the material contained within the vial of "NADSYN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.