Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-MLXIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateMLXIP is supported by BioGPS gene expression data to be expressed in PANC1)

MLX-Interacting Protein (MLXIP) Antibody – Rabbit Polyclonal

MLXIP antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
MLXIP; MIR; MONDOA; bHLHe36
Reactivity
Dog, Human, Mouse, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MLXIP, Antibody; MLXIP antibody - middle region; anti-MLXIP antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP
Sequence Length
919
Applicable Applications for anti-MLXIP antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Human: 100%; Mouse: 79%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MLXIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MLXIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateMLXIP is supported by BioGPS gene expression data to be expressed in PANC1)

Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-MLXIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateMLXIP is supported by BioGPS gene expression data to be expressed in PANC1)

WB (Western Blot)

(Host: RabbitTarget Name: MLXIPSample Type: OVCAR-3Antibody Dilution: 1.0ug/mlMLXIP is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: MLXIPSample Type: OVCAR-3Antibody Dilution: 1.0ug/mlMLXIP is supported by BioGPS gene expression data to be expressed in OVCAR3)

WB (Western Blot)

(Host: RabbitTarget Name: MLXIPSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: MLXIPSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MLXIPSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: MLXIPSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MLXIPSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: MLXIPSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MLXIPSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: MLXIPSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MLXIPSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: MLXIPSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-MLXIP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Rabbit Anti-MLXIP Polyclonal Antibody – Cat# AAA23450 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-MLXIP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-MLXIP antibody
This is a rabbit polyclonal antibody against MLXIP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MONDOA forms heterodimers with MLX (MIM 602976) that can bind to and activate transcription from CACGTG E boxes.
Product Categories/Family for anti-MLXIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
MLX-interacting protein
NCBI Official Synonym Full Names
MLX interacting protein
NCBI Official Symbol
MLXIP
NCBI Official Synonym Symbols
MIR; MONDOA; bHLHe36
NCBI Protein Information
MLX-interacting protein
UniProt Protein Name
MLX-interacting protein
UniProt Gene Name
MLXIP
UniProt Synonym Gene Names
bHLHe36

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The MLXIP mlxip (Catalog #AAA23450) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLXIP antibody - middle region reacts with Dog, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's MLXIP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MLXIP mlxip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEQGCEHTSR TEDPFIQPTD FGPSEPPLSV PQPFLPVFTM PLLSPSPAPP. It is sometimes possible for the material contained within the vial of "MLXIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.