Mannose-Binding Protein C (MBL2) Antibody – Rabbit Polyclonal
MBL2 antibody - middle region
Gene Names
MBL2; MBL; MBP; MBP1; MBPD; MBL2D; MBP-C; COLEC1; HSMBPC
Reactivity
Cow, Goat, Horse, Human, Pig, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MBL2, Antibody; MBL2 antibody - middle region; anti-MBL2 antibody
Product Overview
Host
Rabbit
Reactivity
Cow, Goat, Horse, Human, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer and 0.09% sodium azide
Sequence
Synthetic peptide located within the following region: KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
Sequence Length
248
Applicable Applications for anti-MBL2 antibody
WB (Western Blot)
Homology
Cow: 77%; Goat: 77%; Horse: 92%; Human: 100%; Pig: 92%; Rat: 77%; Sheep: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MBL2
Protein Size (#AA)
248 amino acids
Blocking Peptide
For anti-MBL2 antibody is ( )
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-MBL2 antibody
This is a rabbit polyclonal antibody against MBL2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
Target Description: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
Product Categories/Family for anti-MBL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24
NCBI Official Full Name
mannose-binding protein C
NCBI Official Synonym Full Names
mannose binding lectin 2
NCBI Official Symbol
MBL2
NCBI Official Synonym Symbols
MBL; MBP; MBP1; MBPD; MBL2D; MBP-C; COLEC1; HSMBPC
NCBI Protein Information
mannose-binding protein C
UniProt Protein Name
Mannose-binding protein C
UniProt Gene Name
MBL2
UniProt Synonym Gene Names
MBP-C
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The MBL2 mbl2 (Catalog #AAA199591) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MBL2 antibody - middle region reacts with Cow, Goat, Horse, Human, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's MBL2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MBL2 mbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEEAFLGITD EKTEGQFVDL TGNRLTYTNW NEGEPNNAGS DEDCVLLLKN. It is sometimes possible for the material contained within the vial of "MBL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
