Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-MAPK14 Polyclonal Antibody – Cat# AAA201688 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-MAPK14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateMAPK14 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Mitogen-Activated Protein Kinase 14 Isoform 1 (MAPK14) Antibody – Rabbit Polyclonal

MAPK14 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
MAPK14; RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MAPK14, Antibody; MAPK14 antibody - C-terminal region; anti-MAPK14 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Sequence Length
360
Applicable Applications for anti-MAPK14 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAPK14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateMAPK14 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit Anti-MAPK14 Polyclonal Antibody – Cat# AAA201688 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-MAPK14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateMAPK14 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Host: MouseTarget Name: MAPK14Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Rabbit Anti-MAPK14 Polyclonal Antibody – Cat# AAA201688 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: MAPK14Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-MAPK14 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: Cytoplasm, NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-MAPK14 Polyclonal Antibody – Cat# AAA201688 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-MAPK14 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: Cytoplasm, NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Human Liver)

Rabbit Anti-MAPK14 Polyclonal Antibody – Cat# AAA201688 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Liver)
Related Product Information for anti-MAPK14 antibody
This is a rabbit polyclonal antibody against MAPK14. It was validated on Western Blot and immunohistochemistry

Target Description: MAPK14 encodes a protein which is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
mitogen-activated protein kinase 14 isoform 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 14
NCBI Official Symbol
MAPK14
NCBI Official Synonym Symbols
RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA
NCBI Protein Information
mitogen-activated protein kinase 14
UniProt Protein Name
Mitogen-activated protein kinase 14
UniProt Gene Name
MAPK14
UniProt Synonym Gene Names
CSBP; CSBP1; CSBP2; CSPB1; MXI2; SAPK2A; MAP kinase 14; MAPK 14; CSAID-binding protein; CSBP; MAP kinase p38 alpha; SAPK2a
UniProt Entry Name
MK14_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The MAPK14 mapk14 (Catalog #AAA201688) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK14 antibody - C-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK14 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MAPK14 mapk14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YHDPDDEPVA DPYDQSFESR DLLIDEWKSL TYDEVISFVP PPLDQEEMES. It is sometimes possible for the material contained within the vial of "MAPK14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.