Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28274_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of U-87MG cells using 3ug MAPK14 antibody. Western blot was performed from the immunoprecipitate using MAPK14 antibody at a dilition of 1:1000.)

Rabbit MAPK14 Polyclonal Antibody | anti-MAPK14 antibody

MAPK14 Polyclonal Antibody

Gene Names
MAPK14; RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunoprecipitation
Purity
Affinity Purification
Synonyms
MAPK14, Antibody; MAPK14 Polyclonal Antibody; CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; p38; p38ALPHA; PRKM14; PRKM15; RK; SAPK2A; anti-MAPK14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Sequence Length
360
Applicable Applications for anti-MAPK14 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
Application Notes
WB: 1:500 - 1:1000
IHC: 1:50 - 1:200
IP: 1:50 - 1:200
Immunogen
A synthetic peptide of human MAPK14
Immunogen Species
Human
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of U-87MG cells using 3ug MAPK14 antibody. Western blot was performed from the immunoprecipitate using MAPK14 antibody at a dilition of 1:1000.)

product-image-AAA28274_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of U-87MG cells using 3ug MAPK14 antibody. Western blot was performed from the immunoprecipitate using MAPK14 antibody at a dilition of 1:1000.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse heart using MAPK14 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28274_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse heart using MAPK14 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human placenta using MAPK14 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28274_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human placenta using MAPK14 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver cancer using MAPK14 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28274_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using MAPK14 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using MAPK14 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28274_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using MAPK14 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MAPK14 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

product-image-AAA28274_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MAPK14 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-MAPK14 antibody
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Product Categories/Family for anti-MAPK14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 29kDa; 34kDa; 35kDa; 41kDa
Observed: 41kDa
NCBI Official Full Name
mitogen-activated protein kinase 14 isoform 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase 14
NCBI Official Symbol
MAPK14
NCBI Official Synonym Symbols
RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA
NCBI Protein Information
mitogen-activated protein kinase 14
UniProt Protein Name
Mitogen-activated protein kinase 14
UniProt Gene Name
MAPK14
UniProt Synonym Gene Names
CSBP; CSBP1; CSBP2; CSPB1; MXI2; SAPK2A; MAP kinase 14; MAPK 14; CSAID-binding protein; CSBP; MAP kinase p38 alpha; SAPK2a

Similar Products

Product Notes

The MAPK14 mapk14 (Catalog #AAA28274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK14 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP). WB: 1:500 - 1:1000 IHC: 1:50 - 1:200 IP: 1:50 - 1:200. Researchers should empirically determine the suitability of the MAPK14 mapk14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AQALAHAYFA QYHDPDDEPV ADPYDQSFES RDLLIDEWKS LTYDEVISFV PPPLDQEEME S. It is sometimes possible for the material contained within the vial of "MAPK14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.