Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-LRRC17 Polyclonal Antibody – Cat# AAA200185 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-LRRC17 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

Leucine-Rich Repeat-Containing Protein 17 Isoform 1 (LRRC17) Antibody – Rabbit Polyclonal

LRRC17 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
LRRC17; P37NB
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LRRC17, Antibody; LRRC17 antibody - middle region; anti-LRRC17 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range : 100ul at 0.5-1mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL
Sequence Length
441
Applicable Applications for anti-LRRC17 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LRRC17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LRRC17 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

Rabbit Anti-LRRC17 Polyclonal Antibody – Cat# AAA200185 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-LRRC17 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: LRRC17Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit Anti-LRRC17 Polyclonal Antibody – Cat# AAA200185 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: LRRC17Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LRRC17Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-LRRC17 Polyclonal Antibody – Cat# AAA200185 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: LRRC17Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LRRC17Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-LRRC17 Polyclonal Antibody – Cat# AAA200185 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: LRRC17Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-LRRC17 antibody
This is a rabbit polyclonal antibody against LRRC17. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown.
Product Categories/Family for anti-LRRC17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
leucine-rich repeat-containing protein 17 isoform 1
NCBI Official Synonym Full Names
leucine rich repeat containing 17
NCBI Official Symbol
LRRC17
NCBI Official Synonym Symbols
P37NB
NCBI Protein Information
leucine-rich repeat-containing protein 17
UniProt Protein Name
Leucine-rich repeat-containing protein 17
UniProt Gene Name
LRRC17
UniProt Synonym Gene Names
P37NB; UNQ3076/PRO9909
UniProt Entry Name
LRC17_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The LRRC17 lrrc17 (Catalog #AAA200185) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRRC17 antibody - middle region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LRRC17 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LRRC17 lrrc17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YVFPIQTLDC KRKELKKVPN NIPPDIVKLD LSYNKINQLR PKEFEDVHEL. It is sometimes possible for the material contained within the vial of "LRRC17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.