Lysophosphatidic Acid Receptor 6 (LPAR6) Antibody – Rabbit Polyclonal
LPAR6 Antibody - N-terminal region
Gene Names
LPAR6; LAH3; P2Y5; ARWH1; HYPT8; P2RY5
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LPAR6, Antibody; LPAR6 Antibody - N-terminal region; anti-LPAR6 antibody
Product Overview
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK
Sequence Length
344
Applicable Applications for anti-LPAR6 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LPAR6
Protein Size (# AA)
344 amino acids
Blocking Peptide
For anti-LPAR6 (MBS3217172) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-LPAR6 antibody
This is a rabbit polyclonal antibody against LPAR6. It was validated on Western Blot
Target Description: The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants.
Target Description: The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-LPAR6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
lysophosphatidic acid receptor 6
NCBI Official Synonym Full Names
lysophosphatidic acid receptor 6
NCBI Official Symbol
LPAR6
NCBI Official Synonym Symbols
LAH3; P2Y5; ARWH1; HYPT8; P2RY5
NCBI Protein Information
lysophosphatidic acid receptor 6
UniProt Protein Name
Lysophosphatidic acid receptor 6
UniProt Gene Name
LPAR6
UniProt Synonym Gene Names
P2RY5; LPA receptor 6; LPA-6; P2Y5
UniProt Entry Name
LPAR6_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The LPAR6 lpar6 (Catalog #AAA201381) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LPAR6 Antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LPAR6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LPAR6 lpar6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDLLCKISVM LFYTNMYGSI LFLTCISVDR FLAIVYPFKS KTLRTKRNAK. It is sometimes possible for the material contained within the vial of "LPAR6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
