Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA21310_IHC10.jpg IHC (Immunohistochemistry) (LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded rat heart.)

Rabbit anti-Human LIG3/DNA Ligase III Polyclonal Antibody | anti-LIG3 antibody

LIG3/DNA Ligase III Rabbit anti-Human Polyclonal Antibody

Gene Names
LIG3; LIG2
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Affinity purified
Synonyms
LIG3/DNA Ligase III, Antibody; LIG3/DNA Ligase III Rabbit anti-Human Polyclonal Antibody; IHC-plus LIG3/DNA Ligase III Antibody; LIG3; DNA ligase III; Ligase II; DNA; ATP-dependent; LIG2; Ligase III; DNA ligase 3; anti-LIG3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human LIG3/DNA Ligase III
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration
1.53mg/ml (varies by lot)
Applicable Applications for anti-LIG3 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 1:50-1:100
IHC: 1:50-1:200
IHC-P: 1:200
IP: 1:50-1:200
WB: 1:500-1:2000
The predicted MW is 95kDa/102kDa/106kDa/112kDa, while the observed MW by Western blot was 113kDa.
Target
Human LIG3/DNA Ligase III
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 730-1009 of human LIG3 (NP_039269.2). AGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistochemistry)

(LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded rat heart.)

product-image-AAA21310_IHC10.jpg IHC (Immunohistochemistry) (LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded rat heart.)

IHC (Immunohistchemistry)

(LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded rat brain using LIG3 antibody at dilution of 1:200 (400x lens).)

product-image-AAA21310_IHC9.jpg IHC (Immunohistchemistry) (LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded rat brain using LIG3 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistochemistry)

(LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded human breast cancer using LIG3 antibody at dilution of 1:200 (400x lens).)

product-image-AAA21310_IHC8.jpg IHC (Immunohistochemistry) (LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded human breast cancer using LIG3 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistochemistry)

(LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded mouse heart.)

product-image-AAA21310_IHC7.jpg IHC (Immunohistochemistry) (LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded mouse heart.)

IHC (Immunohistchemistry)

(LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded human esophageal cancer tissue.)

product-image-AAA21310_IHC6.jpg IHC (Immunohistchemistry) (LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded human esophageal cancer tissue.)

IHC (Immunohistochemistry)

(LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded human oophoroma tissue.)

product-image-AAA21310_IHC5.jpg IHC (Immunohistochemistry) (LIG3/DNA Ligase III Antibody-Immunohistochemistry of paraffin-embedded human oophoroma tissue.)

IHC (Immunohistochemistry)

(LIG3/DNA Ligase III Antibody-Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21310_IHC4.jpg IHC (Immunohistochemistry) (LIG3/DNA Ligase III Antibody-Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE))

ICC (Immunocytochemistry)

(LIG3/DNA Ligase III Antibody-Immunofluorescence analysis of MCF7 cell using LIG3 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA21310_ICC3.jpg ICC (Immunocytochemistry) (LIG3/DNA Ligase III Antibody-Immunofluorescence analysis of MCF7 cell using LIG3 antibody. Blue: DAPI for nuclear staining.)

ICC (Immunocytochemistry)

(LIG3/DNA Ligase III Antibody-Immunofluorescence analysis of A549 cells.)

product-image-AAA21310_ICC2.jpg ICC (Immunocytochemistry) (LIG3/DNA Ligase III Antibody-Immunofluorescence analysis of A549 cells.)

ICC (Immunocytochemistry)

(LIG3/DNA Ligase III Antibody-Immunofluorescence analysis of HeLa cells.)

product-image-AAA21310_ICC.jpg ICC (Immunocytochemistry) (LIG3/DNA Ligase III Antibody-Immunofluorescence analysis of HeLa cells.)
Related Product Information for anti-LIG3 antibody
DNA Ligase III antibody is an unconjugated rabbit polyclonal antibody to human DNA Ligase III (LIG3). Validated for IF, IHC, IP and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106,018 Da
NCBI Official Full Name
DNA ligase 3 isoform alpha
NCBI Official Synonym Full Names
ligase III, DNA, ATP-dependent
NCBI Official Symbol
LIG3
NCBI Official Synonym Symbols
LIG2
NCBI Protein Information
DNA ligase 3; ligase II, DNA, ATP-dependent; polydeoxyribonucleotide synthase [ATP] 3
UniProt Protein Name
DNA ligase 3
UniProt Gene Name
LIG3
UniProt Entry Name
DNLI3_HUMAN

Similar Products

Product Notes

The LIG3 lig3 (Catalog #AAA21310) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIG3/DNA Ligase III Rabbit anti-Human Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LIG3/DNA Ligase III can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), Western Blot (WB). IF: 1:50-1:100 IHC: 1:50-1:200 IHC-P: 1:200 IP: 1:50-1:200 WB: 1:500-1:2000 The predicted MW is 95kDa/102kDa/106kDa/112kDa, while the observed MW by Western blot was 113kDa. Researchers should empirically determine the suitability of the LIG3 lig3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LIG3/DNA Ligase III, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.