Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201645_WB10.jpg WB (Western Blot) (WB Suggested Anti-KRT15 antibody Titration: 1 ug/mLSample Type: Human HepG2)

Rabbit KRT15 Polyclonal Antibody | anti-KRT15 antibody

KRT15 antibody - C-terminal region

Gene Names
KRT15; K15; CK15; K1CO
Reactivity
Cow, Human, Mouse
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KRT15, Antibody; KRT15 antibody - C-terminal region; anti-KRT15 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Sequence Length
456
Applicable Applications for anti-KRT15 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Human: 100%; Mouse: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KRT15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KRT15 antibody Titration: 1 ug/mLSample Type: Human HepG2)

product-image-AAA201645_WB10.jpg WB (Western Blot) (WB Suggested Anti-KRT15 antibody Titration: 1 ug/mLSample Type: Human HepG2)

WB (Western Blot)

(WB Suggested Anti-KRT15 antibody Titration: 1 ug/mLSample Type: Human Hela)

product-image-AAA201645_WB11.jpg WB (Western Blot) (WB Suggested Anti-KRT15 antibody Titration: 1 ug/mLSample Type: Human Hela)

WB (Western Blot)

(WB Suggested Anti-KRT15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

product-image-AAA201645_WB13.jpg WB (Western Blot) (WB Suggested Anti-KRT15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

IHC (Immunohistochemistry)

(WB Suggested Anti-KRT15 Antibody Titration: 4.0-8.0Positive Control: Human Intestine)

product-image-AAA201645_IHC15.jpg IHC (Immunohistochemistry) (WB Suggested Anti-KRT15 Antibody Titration: 4.0-8.0Positive Control: Human Intestine)
Related Product Information for anti-KRT15 antibody
This is a rabbit polyclonal antibody against KRT15. It was validated on Western Blot and immunohistochemistry

Target Description: The protein encoded by KRT15 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-KRT15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
keratin, type I cytoskeletal 15
NCBI Official Synonym Full Names
keratin 15
NCBI Official Symbol
KRT15
NCBI Official Synonym Symbols
K15; CK15; K1CO
NCBI Protein Information
keratin, type I cytoskeletal 15
UniProt Protein Name
Keratin, type I cytoskeletal 15
UniProt Gene Name
KRT15
UniProt Synonym Gene Names
KRTB; CK-15; K15
UniProt Entry Name
K1C15_HUMAN

Similar Products

Product Notes

The KRT15 krt15 (Catalog #AAA201645) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT15 antibody - C-terminal region reacts with Cow, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KRT15 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KRT15 krt15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSLLEGQDAK MAGIGIREAS SGGGGSSSNF HINVEESVDG QVVSSHKREI. It is sometimes possible for the material contained within the vial of "KRT15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.