Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-KLF2 Polyclonal Antibody – Cat# AAA198461 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-KLF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Krueppel-Like Factor 2 (KLF2) Antibody – Rabbit Polyclonal

KLF2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
KLF2; LKLF
Reactivity
Tested Reactivity: Human, Mouse
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLF2, Antibody; KLF2 antibody - middle region; anti-KLF2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Reactivity: Human, Mouse
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range : 100uL at 0.2-1mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: NWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRH
Sequence Length
355
Applicable Applications for anti-KLF2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KLF2
Protein Size (# AA)
355 amino acids
Protein Interactions
KAT2B; EP300; CREBBP; FBXW7; UBC; GSK3B; ELAVL1; SMURF1; WWP1; GATA5; GATA6; WEE1
Blocking Peptide
For anti-KLF2 MBS3204513 antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KLF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Rabbit Anti-KLF2 Polyclonal Antibody – Cat# AAA198461 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-KLF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: KLF5Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit Anti-KLF2 Polyclonal Antibody – Cat# AAA198461 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: KLF5Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: KLF5Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit Anti-KLF2 Polyclonal Antibody – Cat# AAA198461 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: KLF5Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Related Product Information for anti-KLF2 antibody
This is a rabbit polyclonal antibody against KLF2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KLF2 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 3 C2H2-type zinc fingers. KLF2 binds to the CACCC box in the beta-globin gene promoter and activates transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
Krueppel-like factor 2
NCBI Official Synonym Full Names
Kruppel like factor 2
NCBI Official Symbol
KLF2
NCBI Official Synonym Symbols
LKLF
NCBI Protein Information
Krueppel-like factor 2
UniProt Protein Name
Krueppel-like factor 2
UniProt Gene Name
KLF2
UniProt Synonym Gene Names
LKLF

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The KLF2 klf2 (Catalog #AAA198461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLF2 antibody - middle region reacts with Tested Reactivity: Human, Mouse Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KLF2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KLF2 klf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NWDGCGWKFA RSDELTRHYR KHTGHRPFQC HLCDRAFSRS DHLALHMKRH. It is sometimes possible for the material contained within the vial of "KLF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.