Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-KIF5B Polyclonal Antibody – Cat# AAA197688 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Kinesin-1 Heavy Chain (KIF5B) Antibody – Rabbit Polyclonal

KIF5B antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KIF5B; KNS; KINH; KNS1; UKHC; HEL-S-61
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KIF5B, Antibody; KIF5B antibody - N-terminal region; anti-KIF5B antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
Sequence Length
963
Applicable Applications for anti-KIF5B antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit Anti-KIF5B Polyclonal Antibody – Cat# AAA197688 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: KIF5BSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-KIF5B Polyclonal Antibody – Cat# AAA197688 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: KIF5BSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human Liver)

Rabbit Anti-KIF5B Polyclonal Antibody – Cat# AAA197688 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Liver)
Related Product Information for anti-KIF5B antibody
This is a rabbit polyclonal antibody against KIF5B. It was validated on Western Blot and immunohistochemistry

Target Description: Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.
Product Categories/Family for anti-KIF5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110kDa
NCBI Official Full Name
kinesin-1 heavy chain
NCBI Official Synonym Full Names
kinesin family member 5B
NCBI Official Symbol
KIF5B
NCBI Official Synonym Symbols
KNS; KINH; KNS1; UKHC; HEL-S-61
NCBI Protein Information
kinesin-1 heavy chain
UniProt Protein Name
Kinesin-1 heavy chain
UniProt Gene Name
KIF5B
UniProt Synonym Gene Names
KNS; KNS1; UKHC
UniProt Entry Name
KINH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The KIF5B kif5b (Catalog #AAA197688) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF5B antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KIF5B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KIF5B kif5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CNIKVMCRFR PLNESEVNRG DKYIAKFQGE DTVVIASKPY AFDRVFQSST. It is sometimes possible for the material contained within the vial of "KIF5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.