Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-KHDRBS3 Polyclonal Antibody – Cat# AAA198733 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-KHDRBS3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

KH Domain-Containing, RNA-Binding, Signal Transduction-Associated Protein 3 (KHDRBS3) Antibody – Rabbit Polyclonal

KHDRBS3 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
KHDRBS3; Etle; SALP; SLM2; SLM-2; TSTAR; T-STAR; etoile
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KHDRBS3, Antibody; KHDRBS3 antibody - C-terminal region; anti-KHDRBS3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS
Sequence Length
346
Applicable Applications for anti-KHDRBS3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KHDRBS3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KHDRBS3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit Anti-KHDRBS3 Polyclonal Antibody – Cat# AAA198733 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-KHDRBS3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-KHDRBS3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-KHDRBS3 Polyclonal Antibody – Cat# AAA198733 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-KHDRBS3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-KHDRBS3 antibody
This is a rabbit polyclonal antibody against KHDRBS3. It was validated on Western Blot and immunohistochemistry

Target Description: As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
KH domain-containing, RNA-binding, signal transduction-associated protein 3
NCBI Official Synonym Full Names
KH RNA binding domain containing, signal transduction associated 3
NCBI Official Symbol
KHDRBS3
NCBI Official Synonym Symbols
Etle; SALP; SLM2; SLM-2; TSTAR; T-STAR; etoile
NCBI Protein Information
KH domain-containing, RNA-binding, signal transduction-associated protein 3
UniProt Protein Name
KH domain-containing, RNA-binding, signal transduction-associated protein 3
UniProt Gene Name
KHDRBS3
UniProt Synonym Gene Names
SALP; SLM2; SLM-2
UniProt Entry Name
KHDR3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The KHDRBS3 khdrbs3 (Catalog #AAA198733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KHDRBS3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KHDRBS3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KHDRBS3 khdrbs3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQSYDSYDNS YSTPAQSGAD YYDYGHGLSE ETYDSYGQEE WTNSRHKAPS. It is sometimes possible for the material contained within the vial of "KHDRBS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.