Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-KRT4 Polyclonal Antibody – Cat# AAA133487 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (DAB staining on IHC-P; Samples: Rat Kidney Tissue))

Keratin, Type II Cytoskeletal 4 (KRT4) Antibody – Rabbit Polyclonal

Polyclonal Antibody to Keratin 4 (KRT4)

Average rating 0.0
No ratings yet
Gene Names
Krt4; Kb4
Reactivity
Human, Rat
Applications
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry
Purity
Affinity Chromatography
Synonyms
Keratin 4 (KRT4), Antibody; Polyclonal Antibody to Keratin 4 (KRT4); anti-KRT4 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against KRT4. It has been selected for its ability to recognize KRT4 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with N-terminal His-Tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-IAEV RAQYEEIARK SKAEVESWYQ IKVQQLQMSA DQHGDSLKST KNEISELNRM IQRIRSEIEN IKKQTLQASV ADAEQRGELA LKDAYTKRAD LETALQKAKE DLARLMRDYQ ELMNVKLALD VEIATYRKLL EGEE
Sequence Length
520
Applicable Applications for anti-KRT4 antibody
WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry)
Immunogen
Recombinant KRT4 (Ile317~Glu454) expressed in E.coli.
Cross Reactivity
Human, Rat
Conjugated Antibody
The APC conjugated antibody version of this item is also available as
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

IHC (Immunohistochemistry)

(DAB staining on IHC-P; Samples: Rat Kidney Tissue))

Rabbit Anti-KRT4 Polyclonal Antibody – Cat# AAA133487 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (DAB staining on IHC-P; Samples: Rat Kidney Tissue))

IHC (Immunohistochemisry)

(DAB staining on IHC-P; Samples: Rat Ovary Tissue))

Rabbit Anti-KRT4 Polyclonal Antibody – Cat# AAA133487 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (DAB staining on IHC-P; Samples: Rat Ovary Tissue))

WB (Western Blot)

(Western Blot: Sample: Recombinant protein.)

Rabbit Anti-KRT4 Polyclonal Antibody – Cat# AAA133487 – WB (Western Blot) WB (Western Blot) (Western Blot: Sample: Recombinant protein.)

WB (Western Blot)

(Western Blot: Sample: Human A431 cell lysate; Primary Ab: 1ug/ml Rabbit Anti-Rat KRT4 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody)

Rabbit Anti-KRT4 Polyclonal Antibody – Cat# AAA133487 – WB (Western Blot) WB (Western Blot) (Western Blot: Sample: Human A431 cell lysate; Primary Ab: 1ug/ml Rabbit Anti-Rat KRT4 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,667 Da
NCBI Official Full Name
keratin, type II cytoskeletal 4
NCBI Official Synonym Full Names
keratin 4
NCBI Official Symbol
Krt4
NCBI Official Synonym Symbols
Kb4
NCBI Protein Information
keratin, type II cytoskeletal 4
UniProt Protein Name
Keratin, type II cytoskeletal 4
UniProt Gene Name
Krt4
UniProt Synonym Gene Names
CK-4; K4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The KRT4 krt4 (Catalog #AAA133487) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Keratin 4 (KRT4) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Keratin 4 (KRT4) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry). Researchers should empirically determine the suitability of the KRT4 krt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with N-terminal His-Tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-IAEV RAQYEEIARK SKAEVESWYQ IKVQQLQMSA DQHGDSLKST KNEISELNRM IQRIRSEIEN IKKQTLQASV ADAEQRGELA LKDAYTKRAD LETALQKAKE DLARLMRDYQ ELMNVKLALD VEIATYRKLL EGEE. It is sometimes possible for the material contained within the vial of "Keratin 4 (KRT4), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.