Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-IRF4 Polyclonal Antibody – Cat# AAA198253 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-IRF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateIRF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Interferon Regulatory Factor 4 Isoform 1 (IRF4) Antibody – Rabbit Polyclonal

IRF4 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
IRF4; MUM1; LSIRF; SHEP8; NF-EM5
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IRF4, Antibody; IRF4 antibody - middle region; anti-IRF4 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Sequence Length
451
Applicable Applications for anti-IRF4 antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IRF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IRF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateIRF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit Anti-IRF4 Polyclonal Antibody – Cat# AAA198253 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-IRF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateIRF4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: IRF4Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit Anti-IRF4 Polyclonal Antibody – Cat# AAA198253 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: IRF4Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IRF4 antibody
This is a rabbit polyclonal antibody against IRF4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IRF4 is a transcriptional activator. It binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter.It also binds the immunoglobulin lambda light chain enhancer, together with PU.1. IRF4 probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
interferon regulatory factor 4 isoform 1
NCBI Official Synonym Full Names
interferon regulatory factor 4
NCBI Official Symbol
IRF4
NCBI Official Synonym Symbols
MUM1; LSIRF; SHEP8; NF-EM5
NCBI Protein Information
interferon regulatory factor 4
UniProt Protein Name
Interferon regulatory factor 4
UniProt Gene Name
IRF4
UniProt Synonym Gene Names
MUM1; IRF-4; LSIRF
UniProt Entry Name
IRF4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The IRF4 irf4 (Catalog #AAA198253) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IRF4 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IRF4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IRF4 irf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAHVEPLLAR QLYYFAQQNS GHFLRGYDLP EHISNPEDYH RSIRHSSIQE. It is sometimes possible for the material contained within the vial of "IRF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.