Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-IRAK4 Polyclonal Antibody – Cat# AAA201092 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-IRAK4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Interleukin-1 Receptor Associated Kinase 4 (IRAK4) Antibody – Rabbit Polyclonal

IRAK4 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
IRAK4; IPD1; REN64; IRAK-4; NY-REN-64
Reactivity
Cow, Guinea Pig, Horse, Human, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IRAK4, Antibody; IRAK4 antibody - C-terminal region; anti-IRAK4 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYS
Sequence Length
336
Applicable Applications for anti-IRAK4 antibody
WB (Western Blot)
Homology
Cow: 77%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Rat: 91%; Sheep: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IRAK4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit Anti-IRAK4 Polyclonal Antibody – Cat# AAA201092 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-IRAK4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: IRAK4Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlIRAK4 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit Anti-IRAK4 Polyclonal Antibody – Cat# AAA201092 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: IRAK4Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlIRAK4 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-IRAK4 antibody
This is a rabbit polyclonal antibody against IRAK4. It was validated on Western Blot

Target Description: This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
interleukin-1 receptor associated kinase 4
NCBI Official Synonym Full Names
interleukin 1 receptor associated kinase 4
NCBI Official Symbol
IRAK4
NCBI Official Synonym Symbols
IPD1; REN64; IRAK-4; NY-REN-64
NCBI Protein Information
interleukin-1 receptor-associated kinase 4
UniProt Protein Name
Interleukin-1 receptor-associated kinase 4
UniProt Gene Name
IRAK4
UniProt Synonym Gene Names
IRAK-4
UniProt Entry Name
IRAK4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The IRAK4 irak4 (Catalog #AAA201092) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IRAK4 antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IRAK4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IRAK4 irak4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGLPAVDEHR EPQLLLDIKE EIEDEEKTIE DYIDKKMNDA DSTSVEAMYS. It is sometimes possible for the material contained within the vial of "IRAK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.