Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-IFT140 Polyclonal Antibody – Cat# AAA198099 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-IFT140 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Intraflagellar Transport Protein 140 Homolog (IFT140) Antibody – Rabbit Polyclonal

IFT140 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
IFT140; RP80; MZSDS; SRTD9; WDTC2; gs114; c305C8.4; c380F5.1
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IFT140, Antibody; IFT140 antibody - N-terminal region; anti-IFT140 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF
Sequence Length
1462
Applicable Applications for anti-IFT140 antibody
WB (Western Blot)
Homology
Cow: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IFT140
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IFT140 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit Anti-IFT140 Polyclonal Antibody – Cat# AAA198099 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-IFT140 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

WB (Western Blot)

(Sample Type: human and mouseSample Type: 1. Human RPE cell line (15ug)2. Bovine retina lysate cleared at 100,000Xg for 2 hours (15ug)Primary Dilution: 1:1000Secondary Anditbody: goat anti-rabbit HRPScondary Dilution: 1:10,000Image Submitted By: Gerald LiewStanford University)

Rabbit Anti-IFT140 Polyclonal Antibody – Cat# AAA198099 – WB (Western Blot) WB (Western Blot) (Sample Type: human and mouseSample Type: 1. Human RPE cell line (15ug)2. Bovine retina lysate cleared at 100,000Xg for 2 hours (15ug)Primary Dilution: 1:1000Secondary Anditbody: goat anti-rabbit HRPScondary Dilution: 1:10,000Image Submitted By: Gerald LiewStanford University)
Related Product Information for anti-IFT140 antibody
This is a rabbit polyclonal antibody against IFT140. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IFT140 contains 9 TPR repeats and 5 WD repeats. The function of the IFT140 protein remains unknown.
Product Categories/Family for anti-IFT140 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
165kDa
NCBI Official Full Name
intraflagellar transport protein 140 homolog
NCBI Official Synonym Full Names
intraflagellar transport 140
NCBI Official Symbol
IFT140
NCBI Official Synonym Symbols
RP80; MZSDS; SRTD9; WDTC2; gs114; c305C8.4; c380F5.1
NCBI Protein Information
intraflagellar transport protein 140 homolog
UniProt Protein Name
Intraflagellar transport protein 140 homolog
UniProt Gene Name
IFT140
UniProt Synonym Gene Names
KIAA0590; WDTC2
UniProt Entry Name
IF140_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The IFT140 ift140 (Catalog #AAA198099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFT140 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFT140 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IFT140 ift140 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLRWSPSGNC LLSGDRLGVL LLWRLDQRGR VQGTPLLKHE YGKHLTHCIF. It is sometimes possible for the material contained within the vial of "IFT140, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.