Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28269_IHC9.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using IFI16 Antibody at dilution of 1:100 (40x lens).)

Rabbit IFI16 Polyclonal Antibody | anti-IFI16 antibody

IFI16 Polyclonal Antibody

Gene Names
IFI16; PYHIN2; IFNGIP1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
IFI16, Antibody; IFI16 Polyclonal Antibody; IFNGIP1; PYHIN2; anti-IFI16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFEDIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPKGSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNG
Sequence Length
729
Applicable Applications for anti-IFI16 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human IFI16
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using IFI16 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28269_IHC9.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using IFI16 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse liver using IFI16 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28269_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse liver using IFI16 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using IFI16 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28269_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse lung using IFI16 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded human kidney cancer using IFI16 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28269_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded human kidney cancer using IFI16 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using IFI16 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28269_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat kidney using IFI16 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat liver using IFI16 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28269_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat liver using IFI16 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat lung using IFI16 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28269_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using IFI16 Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat intestine using IFI16 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28269_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat intestine using IFI16 Antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using IFI16 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA28269_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using IFI16 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-IFI16 antibody
This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-IFI16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 75kDa; 82kDa; 88kDa
Observed: 88kDa
NCBI Official Full Name
gamma-interferon-inducible protein 16 isoform 1
NCBI Official Synonym Full Names
interferon gamma inducible protein 16
NCBI Official Symbol
IFI16
NCBI Official Synonym Symbols
PYHIN2; IFNGIP1
NCBI Protein Information
gamma-interferon-inducible protein 16
UniProt Protein Name
Gamma-interferon-inducible protein 16
UniProt Gene Name
IFI16
UniProt Synonym Gene Names
IFNGIP1; Ifi-16

Similar Products

Product Notes

The IFI16 ifi16 (Catalog #AAA28269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFI16 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFI16 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the IFI16 ifi16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGKKYKNIVL LKGLEVINDY HFRMVKSLLS NDLKLNLKMR EEYDKIQIAD LMEEKFRGDA GLGKLIKIFE DIPTLEDLAE TLKKEKLKVK GPALSRKRKK EVDATSPAPS TSSTVKTEGA EATPGAQKRK KSTKEKAGPK GSKVSEEQTQ PPSPAGAGMS TAMGRSPSPK TSLSAPPNSS STENPKTVAK CQVTPRRNVL QKRPVIVKVL STTKPFEYET PEMEKKIMFH ATVATQTQFF HVKVLNTSLK EKFNG. It is sometimes possible for the material contained within the vial of "IFI16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.