Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HTR3A Polyclonal Antibody – Cat# AAA201718 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

5-Hydroxytryptamine Receptor 3A Isoform B (HTR3A) Antibody – Rabbit Polyclonal

HTR3A antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HTR3A; HTR3; 5HT3R; 5-HT-3; 5-HT3A; 5-HT3R
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Synonyms
HTR3A, Antibody; HTR3A antibody - N-terminal region; anti-HTR3A antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
Sequence Length
478
Applicable Applications for anti-HTR3A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit Anti-HTR3A Polyclonal Antibody – Cat# AAA201718 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: 5HT3ASample Type: RPMI-8226 lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-HTR3A Polyclonal Antibody – Cat# AAA201718 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: 5HT3ASample Type: RPMI-8226 lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: 5HT3ASample Type: 721_B Whole Cell lysatesAntibody Dilution: 5ug/ml)

Rabbit Anti-HTR3A Polyclonal Antibody – Cat# AAA201718 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: 5HT3ASample Type: 721_B Whole Cell lysatesAntibody Dilution: 5ug/ml)

IHC (Immunohistochemistry)

(Human kidney)

Rabbit Anti-HTR3A Polyclonal Antibody – Cat# AAA201718 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-HTR3A antibody
This is a rabbit polyclonal antibody against HTR3A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-HTR3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 3A isoform b
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 3A
NCBI Official Symbol
HTR3A
NCBI Official Synonym Symbols
HTR3; 5HT3R; 5-HT-3; 5-HT3A; 5-HT3R
NCBI Protein Information
5-hydroxytryptamine receptor 3A
UniProt Protein Name
5-hydroxytryptamine receptor 3A
UniProt Gene Name
HTR3A
UniProt Synonym Gene Names
5HT3R; HTR3; 5-HT3-A; 5-HT3A; 5-HT-3; 5-HT3R
UniProt Entry Name
5HT3A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HTR3A htr3a (Catalog #AAA201718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTR3A antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HTR3A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HTR3A htr3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLLPTLLAQG EARRSRNTTR PALLRLSDYL LTNYRKGVRP VRDWRKPTTV. It is sometimes possible for the material contained within the vial of "HTR3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.