Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23609_WB7.jpg WB (Western Blot) (WB Suggested Anti-HTR2C Antibody Titration: 5.0ug/mlPositive Control:A:Daudi cell lysateB:Raji cell lysate)

Rabbit HTR2C Polyclonal Antibody | anti-HTR2C antibody

HTR2C antibody - N-terminal region

Gene Names
HTR2C; HTR1C; 5-HT1C; 5-HT2C; 5HTR2C; 5-HTR2C
Reactivity
Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
HTR2C, Antibody; HTR2C antibody - N-terminal region; anti-HTR2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
Sequence Length
458
Applicable Applications for anti-HTR2C antibody
Western Blot (WB)
Homology
Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HTR2C Antibody Titration: 5.0ug/mlPositive Control:A:Daudi cell lysateB:Raji cell lysate)

product-image-AAA23609_WB7.jpg WB (Western Blot) (WB Suggested Anti-HTR2C Antibody Titration: 5.0ug/mlPositive Control:A:Daudi cell lysateB:Raji cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: HTR2CSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23609_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: HTR2CSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HTR2CSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23609_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: HTR2CSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HTR2CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23609_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: HTR2CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HTR2CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23609_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: HTR2CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HTR2CSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23609_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: HTR2CSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HTR2CSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23609_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: HTR2CSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HTR2C antibody
This is a rabbit polyclonal antibody against HTR2C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with g proteins that activate a phosphatidylinositol . calcium second messenger system.
Product Categories/Family for anti-HTR2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 2C isoform a
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 2C
NCBI Official Symbol
HTR2C
NCBI Official Synonym Symbols
HTR1C; 5-HT1C; 5-HT2C; 5HTR2C; 5-HTR2C
NCBI Protein Information
5-hydroxytryptamine receptor 2C
UniProt Protein Name
5-hydroxytryptamine receptor 2C
UniProt Gene Name
HTR2C
UniProt Synonym Gene Names
HTR1C; 5-HT-2C; 5-HT2C; 5-HTR2C; 5-HT-1C; 5-HT1C
UniProt Entry Name
5HT2C_HUMAN

Similar Products

Product Notes

The HTR2C htr2c (Catalog #AAA23609) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTR2C antibody - N-terminal region reacts with Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HTR2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HTR2C htr2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPVAAIVTDI FNTSDGGRFK FPDGVQNWPA LSIVIIIIMT IGGNILVIMA. It is sometimes possible for the material contained within the vial of "HTR2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.