Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HSD3B1 Polyclonal Antibody – Cat# AAA198999 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSD3B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

3 Beta-Hydroxysteroid Dehydrogenase/Delta 5 - >4-Isomerase Type 1 (HSD3B1) Antibody – Rabbit Polyclonal

HSD3B1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HSD3B1; HSD3B; HSDB3; HSDB3A; SDR11E1; 3BETAHSD
Reactivity
Cow, Goat, Horse, Human, Pig, Rat, Sheep, Monkey
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HSD3B1, Antibody; HSD3B1 antibody - N-terminal region; anti-HSD3B1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Goat, Horse, Human, Pig, Rat, Sheep, Monkey
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
Sequence Length
373
Applicable Applications for anti-HSD3B1 antibody
WB (Western Blot)
Homology
Cow: 79%; Goat: 82%; Horse: 79%; Human: 100%; Pig: 79%; Rat: 79%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HSD3B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Rabbit Anti-HSD3B1 Polyclonal Antibody – Cat# AAA198999 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSD3B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: HSD3B1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit Anti-HSD3B1 Polyclonal Antibody – Cat# AAA198999 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: HSD3B1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Sample Type: Monkey brain extractLanes :Lane 1: 50ug monkey brain extractPrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :HSD3B1Submitted by :Jonathan Bertin, Endoceutics Inc.)

Rabbit Anti-HSD3B1 Polyclonal Antibody – Cat# AAA198999 – WB (Western Blot) WB (Western Blot) (Sample Type: Monkey brain extractLanes :Lane 1: 50ug monkey brain extractPrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :HSD3B1Submitted by :Jonathan Bertin, Endoceutics Inc.)
Related Product Information for anti-HSD3B1 antibody
This is a rabbit polyclonal antibody against HSD3B1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Product Categories/Family for anti-HSD3B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
NCBI Official Synonym Full Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
NCBI Official Symbol
HSD3B1
NCBI Official Synonym Symbols
HSD3B; HSDB3; HSDB3A; SDR11E1; 3BETAHSD
NCBI Protein Information
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
UniProt Gene Name
HSD3B1
UniProt Synonym Gene Names
3BH; HSDB3A; 3-beta-HSD I
UniProt Entry Name
3BHS1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HSD3B1 hsd3b1 (Catalog #AAA198999) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD3B1 antibody - N-terminal region reacts with Cow, Goat, Horse, Human, Pig, Rat, Sheep, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's HSD3B1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HSD3B1 hsd3b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGWSCLVTGA GGFLGQRIIR LLVKEKELKE IRVLDKAFGP ELREEFSKLQ. It is sometimes possible for the material contained within the vial of "HSD3B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.