Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HSD17B6 Polyclonal Antibody – Cat# AAA198933 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSD17B6 Antibody Titration: 1.25ug/mlPositive Control: A172 cell lysateHSD17B6 is strongly supported by BioGPS gene expression data to be expressed in Human A172 cells)

17-Beta-Hydroxysteroid Dehydrogenase Type 6 (HSD17B6) Antibody – Rabbit Polyclonal

HSD17B6 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HSD17B6; HSE; RODH; SDR9C6
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
HSD17B6, Antibody; HSD17B6 antibody - N-terminal region; anti-HSD17B6 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
Sequence Length
317
Applicable Applications for anti-HSD17B6 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HSD17B6 Antibody Titration: 1.25ug/mlPositive Control: A172 cell lysateHSD17B6 is strongly supported by BioGPS gene expression data to be expressed in Human A172 cells)

Rabbit Anti-HSD17B6 Polyclonal Antibody – Cat# AAA198933 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSD17B6 Antibody Titration: 1.25ug/mlPositive Control: A172 cell lysateHSD17B6 is strongly supported by BioGPS gene expression data to be expressed in Human A172 cells)

IHC (Immunohistochemistry)

(Rabbit Anti-HSD17B6 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HemopoieticAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-HSD17B6 Polyclonal Antibody – Cat# AAA198933 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-HSD17B6 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HemopoieticAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-HSD17B6 antibody
This is a rabbit polyclonal antibody against HSD17B6. It was validated on Western Blot and immunohistochemistry

Target Description: HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
17-beta-hydroxysteroid dehydrogenase type 6
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 6
NCBI Official Symbol
HSD17B6
NCBI Official Synonym Symbols
HSE; RODH; SDR9C6
NCBI Protein Information
17-beta-hydroxysteroid dehydrogenase type 6
UniProt Protein Name
17-beta-hydroxysteroid dehydrogenase type 6
UniProt Gene Name
HSD17B6
UniProt Synonym Gene Names
RODH; 17-beta-HSD 6; 17-beta-HSD6; 3-alpha->beta-HSE
UniProt Entry Name
H17B6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HSD17B6 hsd17b6 (Catalog #AAA198933) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD17B6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HSD17B6 hsd17b6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MWLYLAAFVG LYYLLHWYRE RQVVSHLQDK YVFITGCDSG FGNLLARQLD. It is sometimes possible for the material contained within the vial of "HSD17B6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.