Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HS6ST3 Polyclonal Antibody – Cat# AAA199973 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HS6ST3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Heparan-Sulfate 6-O-Sulfotransferase 3 (HS6ST3) Antibody – Rabbit Polyclonal

HS6ST3 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
HS6ST3; HS6ST-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HS6ST3, Antibody; HS6ST3 antibody - C-terminal region; anti-HS6ST3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
Sequence Length
471
Applicable Applications for anti-HS6ST3 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human HS6ST3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HS6ST3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit Anti-HS6ST3 Polyclonal Antibody – Cat# AAA199973 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HS6ST3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

WB (Western Blot)

(Host: MouseTarget Name: HS6ST3Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit Anti-HS6ST3 Polyclonal Antibody – Cat# AAA199973 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: HS6ST3Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Related Product Information for anti-HS6ST3 antibody
This is a rabbit polyclonal antibody against HS6ST3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes.Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammation, blood coagulation, and other diverse processes (Habuchi et al., 2000 [PubMed 10644753]).[supplied by OMIM].
Product Categories/Family for anti-HS6ST3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
heparan-sulfate 6-O-sulfotransferase 3
NCBI Official Synonym Full Names
heparan sulfate 6-O-sulfotransferase 3
NCBI Official Symbol
HS6ST3
NCBI Official Synonym Symbols
HS6ST-3
NCBI Protein Information
heparan-sulfate 6-O-sulfotransferase 3
UniProt Protein Name
Heparan-sulfate 6-O-sulfotransferase 3
UniProt Gene Name
HS6ST3
UniProt Synonym Gene Names
HS6ST-3

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HS6ST3 hs6st3 (Catalog #AAA199973) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HS6ST3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HS6ST3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HS6ST3 hs6st3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TKQLEHQRDR QKRREERRLQ REHRDHQWPK EDGAAEGTVT EDYNSQVVRW. It is sometimes possible for the material contained within the vial of "HS6ST3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.