Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197799_WB11.jpg WB (Western Blot) (WB Suggested Anti-HOXB7 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Rabbit HOXB7 Polyclonal Antibody | anti-HOXB7 antibody

HOXB7 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
HOXB7; HOX2; HOX2C; HHO.C1; Hox-2.3
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Protein A purified
Synonyms
HOXB7, Antibody; HOXB7 antibody - C-terminal region; anti-HOXB7 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
Sequence Length
217
Applicable Applications for anti-HOXB7 antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Cow: 100%; Dog: 77%; Horse: 79%; Human: 100%; Mouse: 92%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HOXB7 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

product-image-AAA197799_WB11.jpg WB (Western Blot) (WB Suggested Anti-HOXB7 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

IF (Immunofluorescence)

(Sample Type :SKOV3Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :HOXB7)

product-image-AAA197799_IF13.jpg IF (Immunofluorescence) (Sample Type :SKOV3Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :HOXB7)

IF (Immunofluorescence)

(Sample Type :HCT116Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :HOXB7)

product-image-AAA197799_IF15.jpg IF (Immunofluorescence) (Sample Type :HCT116Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :HOXB7)
Related Product Information for anti-HOXB7 antibody
This is a rabbit polyclonal antibody against HOXB7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HOXB7 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXBThis gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
homeobox protein Hox-B7
NCBI Official Synonym Full Names
homeobox B7
NCBI Official Symbol
HOXB7
NCBI Official Synonym Symbols
HOX2; HOX2C; HHO.C1; Hox-2.3
NCBI Protein Information
homeobox protein Hox-B7
UniProt Protein Name
Homeobox protein Hox-B7
UniProt Gene Name
HOXB7
UniProt Synonym Gene Names
HOX2C
UniProt Entry Name
HXB7_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HOXB7 hoxb7 (Catalog #AAA197799) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXB7 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HOXB7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the HOXB7 hoxb7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEIAHTLCLT ERQIKIWFQN RRMKWKKENK TAGPGTTGQD RAEAEEEEEE. It is sometimes possible for the material contained within the vial of "HOXB7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.