Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HOXB5 Polyclonal Antibody – Cat# AAA197172 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HOXB5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Homeobox Protein Hox-B5 (HOXB5) Antibody – Rabbit Polyclonal

HOXB5 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HOXB5; HOX2; HU-1; HOX2A; Hox2.1; HHO.C10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HOXB5, Antibody; HOXB5 antibody - N-terminal region; anti-HOXB5 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN
Sequence Length
269
Applicable Applications for anti-HOXB5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HOXB5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit Anti-HOXB5 Polyclonal Antibody – Cat# AAA197172 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HOXB5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: HOXB5Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Rabbit Anti-HOXB5 Polyclonal Antibody – Cat# AAA197172 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: HOXB5Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Human Pancrease lysate)

Rabbit Anti-HOXB5 Polyclonal Antibody – Cat# AAA197172 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Pancrease lysate)
Related Product Information for anti-HOXB5 antibody
This is a rabbit polyclonal antibody against HOXB5. It was validated on Western Blot and immunohistochemistry

Target Description: HOXB5 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
homeobox protein Hox-B5
NCBI Official Synonym Full Names
homeobox B5
NCBI Official Symbol
HOXB5
NCBI Official Synonym Symbols
HOX2; HU-1; HOX2A; Hox2.1; HHO.C10
NCBI Protein Information
homeobox protein Hox-B5
UniProt Protein Name
Homeobox protein Hox-B5
UniProt Gene Name
HOXB5
UniProt Synonym Gene Names
HOX2A
UniProt Entry Name
HXB5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HOXB5 hoxb5 (Catalog #AAA197172) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXB5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HOXB5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HOXB5 hoxb5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSYFVNSFS GRYPNGPDYQ LLNYGSGSSL SGSYRDPAAM HTGSYGYNYN. It is sometimes possible for the material contained within the vial of "HOXB5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.