Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HOXA10 Polyclonal Antibody – Cat# AAA201748 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HOXA10 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Homeobox Protein Hox-A10 (HOXA10) Antibody – Rabbit Polyclonal

HOXA10 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HOXA10; PL; HOX1; HOX1H; HOX1.8
Reactivity
Dog, Human, Mouse, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
HOXA10, Antibody; HOXA10 antibody - N-terminal region; anti-HOXA10 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP
Sequence Length
393
Applicable Applications for anti-HOXA10 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 85%; Human: 92%; Mouse: 78%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HOXA10 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Rabbit Anti-HOXA10 Polyclonal Antibody – Cat# AAA201748 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HOXA10 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human Muscle)

Rabbit Anti-HOXA10 Polyclonal Antibody – Cat# AAA201748 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-HOXA10 antibody
This is a rabbit polyclonal antibody against HOXA10. It was validated on Western Blot and immunohistochemistry

Target Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA10 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
homeobox protein Hox-A10
NCBI Official Synonym Full Names
homeobox A10
NCBI Official Symbol
HOXA10
NCBI Official Synonym Symbols
PL; HOX1; HOX1H; HOX1.8
NCBI Protein Information
homeobox protein Hox-A10
UniProt Protein Name
Homeobox protein Hox-A10
UniProt Gene Name
HOXA10
UniProt Synonym Gene Names
HOX1H
UniProt Entry Name
HXA10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HOXA10 hoxa10 (Catalog #AAA201748) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXA10 antibody - N-terminal region reacts with Dog, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's HOXA10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HOXA10 hoxa10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSCSESPAAN SFLVDSLISS GRGEAGGGGG GAGGGGGGGY YAHGGVYLPP. It is sometimes possible for the material contained within the vial of "HOXA10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.