Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224259_IHC11.jpg IHC (Immunohistochemisry) (HNRPD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X)

Rabbit HNRPD Polyclonal Antibody | anti-HNRPD antibody

HNRPD antibody

Average rating 0.0
No ratings yet
Gene Names
HNRNPD; P37; AUF1; AUF1A; HNRPD; hnRNPD0
Reactivity
Human, Rat, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
HNRPD, Antibody; HNRPD antibody; Polyclonal HNRPD; Anti-HNRPD; Heterogeneous Nuclear Ribonucleoprotein D; Au-Rich Element Rna Binding Protein 1; anti-HNRPD antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat, Dog
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPD antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
336
Applicable Applications for anti-HNRPD antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
HNRPD belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.
Cross-Reactivity
Human,Rat,Dog
Immunogen
HNRPD antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohistochemisry)

(HNRPD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X)

product-image-AAA224259_IHC11.jpg IHC (Immunohistochemisry) (HNRPD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X)

WB (Western Blot)

(HNRPD antibody (AAA224259) used at 1.25 ug/ml to detect target protein.)

product-image-AAA224259_WB13.jpg WB (Western Blot) (HNRPD antibody (AAA224259) used at 1.25 ug/ml to detect target protein.)

IHC (Immunohistochemistry)

(HNRPD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.)

product-image-AAA224259_IHC15.jpg IHC (Immunohistochemistry) (HNRPD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.)
Related Product Information for anti-HNRPD antibody
Rabbit polyclonal HNRPD antibody
Product Categories/Family for anti-HNRPD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
39 kDa (MW of target protein)
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein D
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
NCBI Official Symbol
HNRNPD
NCBI Official Synonym Symbols
P37; AUF1; AUF1A; HNRPD; hnRNPD0
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein D0
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein D0
UniProt Gene Name
HNRNPD
UniProt Synonym Gene Names
AUF1; HNRPD; hnRNP D0
UniProt Entry Name
HNRPD_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HNRPD hnrnpd (Catalog #AAA224259) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRPD antibody reacts with Human, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's HNRPD can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HNRPD hnrnpd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.