Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HMGB2 Polyclonal Antibody – Cat# AAA46646 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (HMGB2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

High Mobility Group Protein B2 (HMGB2) Antibody – Rabbit Polyclonal

Anti-HMGB2 Antibody

Average rating 0.0
No ratings yet
Gene Names
HMGB2; HMG2
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
HMGB2, Antibody; Anti-HMGB2 Antibody; C80539; HMG2; HMG-2; HMG 2; HMG B2; HMGB2; P26583; High mobility group protein B2; high mobility group box 2; anti-HMGB2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
209
Applicable Applications for anti-HMGB2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HMGB2 (65-97aa KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR), identical to the related mouse and rat sequences.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(HMGB2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Anti-HMGB2 Polyclonal Antibody – Cat# AAA46646 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (HMGB2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(HMGB2 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Anti-HMGB2 Polyclonal Antibody – Cat# AAA46646 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (HMGB2 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(HMGB2 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Anti-HMGB2 Polyclonal Antibody – Cat# AAA46646 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (HMGB2 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of HMGB2 expression in rat liver extract (lane 1) and human placenta extract (lane 2). HMGB2 at 24KD was detected using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Rabbit Anti-HMGB2 Polyclonal Antibody – Cat# AAA46646 – WB (Western Blot) WB (Western Blot) (Western blot analysis of HMGB2 expression in rat liver extract (lane 1) and human placenta extract (lane 2). HMGB2 at 24KD was detected using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-HMGB2 antibody
Rabbit IgG polyclonal antibody for High mobility group protein B2 (HMGB2) detection.
Background: High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
References
1. "Entrez Gene: HMGB2 high-mobility group box 2".
2. Majumdar A, Brown D, Kerby S, Rudzinski I, Polte T, Randhawa Z, Seidman MM (Dec 1991). "Sequence of human HMG2 cDNA". Nucleic Acids Research 19 (23): 6643.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,034 Da
NCBI Official Full Name
high mobility group protein B2
NCBI Official Synonym Full Names
high mobility group box 2
NCBI Official Symbol
HMGB2
NCBI Official Synonym Symbols
HMG2
NCBI Protein Information
high mobility group protein B2
UniProt Protein Name
High mobility group protein B2
UniProt Gene Name
HMGB2
UniProt Synonym Gene Names
HMG2; HMG-2
UniProt Entry Name
HMGB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HMGB2 hmgb2 (Catalog #AAA46646) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-HMGB2 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's HMGB2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HMGB2 hmgb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMGB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.